Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KAL6

Protein Details
Accession A0A0A2KAL6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-49LTAHHGPVRPPRRRPKEEVASLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019481  TFIIIC_triple_barrel  
Pfam View protein in Pfam  
PF10419  TFIIIC_sub6  
Amino Acid Sequences MVDSESDGEYEYEYGTETETFYLNLDLTAHHGPVRPPRRRPKEEVASLEDTQNPADNMSQGFPSEAYPPIESAETGNLPNERIQILDLHTSNPIISYYNQMFSCSWADQIGTELVFASPDAETDPDNHFPQSLHRGPSYELLAANSVKILGRKAHLAPNAGPGPAQGFNEGPSNTGSASESASSQAAEPLGAPRRPAVPSHQAQFLYRLQQIKNAKGEQDTVRTVMSTRRNVNMVDRQQGWARTEAQLAEIERLNERASRGDLEATATLELLIQELNPEAESESDSELTSDSDDLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.1
6 0.1
7 0.11
8 0.1
9 0.11
10 0.1
11 0.1
12 0.09
13 0.08
14 0.12
15 0.14
16 0.14
17 0.15
18 0.17
19 0.2
20 0.31
21 0.41
22 0.45
23 0.53
24 0.64
25 0.73
26 0.78
27 0.84
28 0.84
29 0.84
30 0.84
31 0.8
32 0.76
33 0.71
34 0.64
35 0.57
36 0.48
37 0.38
38 0.3
39 0.26
40 0.19
41 0.14
42 0.14
43 0.13
44 0.12
45 0.13
46 0.13
47 0.11
48 0.11
49 0.11
50 0.11
51 0.12
52 0.13
53 0.15
54 0.15
55 0.15
56 0.15
57 0.15
58 0.14
59 0.13
60 0.14
61 0.13
62 0.12
63 0.14
64 0.13
65 0.14
66 0.15
67 0.15
68 0.12
69 0.11
70 0.12
71 0.11
72 0.13
73 0.16
74 0.16
75 0.15
76 0.16
77 0.15
78 0.15
79 0.13
80 0.12
81 0.09
82 0.09
83 0.13
84 0.14
85 0.18
86 0.18
87 0.2
88 0.19
89 0.2
90 0.22
91 0.17
92 0.16
93 0.12
94 0.12
95 0.1
96 0.12
97 0.1
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.08
111 0.12
112 0.14
113 0.15
114 0.15
115 0.15
116 0.14
117 0.17
118 0.23
119 0.22
120 0.22
121 0.22
122 0.23
123 0.23
124 0.26
125 0.24
126 0.17
127 0.14
128 0.12
129 0.13
130 0.12
131 0.11
132 0.08
133 0.07
134 0.06
135 0.07
136 0.07
137 0.07
138 0.08
139 0.11
140 0.13
141 0.17
142 0.19
143 0.21
144 0.2
145 0.25
146 0.25
147 0.22
148 0.2
149 0.15
150 0.15
151 0.15
152 0.14
153 0.09
154 0.09
155 0.1
156 0.13
157 0.13
158 0.12
159 0.11
160 0.11
161 0.1
162 0.1
163 0.1
164 0.07
165 0.08
166 0.07
167 0.07
168 0.08
169 0.08
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.1
177 0.15
178 0.15
179 0.16
180 0.16
181 0.19
182 0.2
183 0.21
184 0.23
185 0.27
186 0.3
187 0.32
188 0.36
189 0.34
190 0.33
191 0.36
192 0.32
193 0.28
194 0.28
195 0.29
196 0.25
197 0.32
198 0.36
199 0.37
200 0.41
201 0.38
202 0.36
203 0.34
204 0.38
205 0.34
206 0.34
207 0.3
208 0.25
209 0.23
210 0.21
211 0.21
212 0.23
213 0.28
214 0.3
215 0.31
216 0.33
217 0.35
218 0.36
219 0.42
220 0.45
221 0.42
222 0.41
223 0.39
224 0.39
225 0.41
226 0.43
227 0.38
228 0.32
229 0.3
230 0.25
231 0.26
232 0.23
233 0.21
234 0.21
235 0.2
236 0.19
237 0.18
238 0.18
239 0.17
240 0.18
241 0.18
242 0.17
243 0.17
244 0.18
245 0.18
246 0.2
247 0.2
248 0.21
249 0.2
250 0.21
251 0.21
252 0.19
253 0.16
254 0.14
255 0.12
256 0.11
257 0.1
258 0.07
259 0.06
260 0.05
261 0.06
262 0.06
263 0.07
264 0.07
265 0.07
266 0.08
267 0.08
268 0.1
269 0.11
270 0.13
271 0.13
272 0.13
273 0.13
274 0.13
275 0.13
276 0.12
277 0.11