FuNGI

A0A0A2L9S5

Protein Details

Accession

A0A0A2L9S5

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
82-111	ISMKRQAYRSKSMSRRRRRRREDGVEEVGD	Hydrophilic

NLS Segment(s)

Position	Sequence
90-102	RSKSMSRRRRRRR

Subcellular Location(s)

nucl 20.5, cyto_nucl 14, cyto 6.5

Family & Domain DBs

InterPro	View protein in InterPro IPR028133 Dynamitin
Gene Ontology	GO:0005737 C:cytoplasm GO:0005869 C:dynactin complex GO:0007017 P:microtubule-based process
Pfam	View protein in Pfam PF04912 Dynamitin

Amino Acid Sequences

MSFNKKYAGLPDLDPSPDIYETPDLTDEASTLPTATIRTDSDHDDAGSNSDIDREGVNPDQARMHFMGAAVDTRDVNFSDSISMKRQAYRSKSMSRRRRRRREDGVEEVGDLSDSEDESLERRLARLRREVEDLKVEMANKKDSTGAENGSSQGVAAAEKPGENLGDGVAELSRALDNLHASRGAATSSHSAAALLSQKLESGTRPTSGANTQSSTDVSKAVSTVPAPTASSAGILSHAAAFDNRLALLESSMGISSSSNPFIADGINESTSHAVLPSLDQLTSRLSALTGLLVGTSQASATPGVPNAAPGMTTPHLEALSTRVRKLTTDAEALTAARRKAFEAAKAVHNARLASSDADVVPALEASTDDDHVAKIQALYTTLPTIQSLHPLLPSVLERLRSLRACHSGAAHAADSLNELEKRHAEMASEIEQWREGLTTVEEKMQQGEAALRSNVEIVEPWVRDLESRLARLEAPPAL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.26
3	0.25
4	0.22
5	0.2
6	0.19
7	0.2
8	0.19
9	0.21
10	0.21
11	0.18
12	0.18
13	0.18
14	0.15
15	0.12
16	0.12
17	0.1
18	0.09
19	0.09
20	0.09
21	0.1
22	0.11
23	0.12
24	0.13
25	0.16
26	0.19
27	0.23
28	0.24
29	0.25
30	0.25
31	0.23
32	0.22
33	0.21
34	0.2
35	0.15
36	0.13
37	0.13
38	0.12
39	0.12
40	0.12
41	0.1
42	0.13
43	0.15
44	0.2
45	0.2
46	0.21
47	0.25
48	0.24
49	0.28
50	0.25
51	0.24
52	0.2
53	0.19
54	0.19
55	0.15
56	0.17
57	0.13
58	0.13
59	0.12
60	0.12
61	0.13
62	0.12
63	0.13
64	0.12
65	0.11
66	0.14
67	0.15
68	0.18
69	0.21
70	0.25
71	0.25
72	0.29
73	0.35
74	0.4
75	0.45
76	0.51
77	0.54
78	0.6
79	0.68
80	0.74
81	0.79
82	0.82
83	0.86
84	0.88
85	0.92
86	0.92
87	0.93
88	0.93
89	0.93
90	0.91
91	0.88
92	0.84
93	0.73
94	0.63
95	0.53
96	0.41
97	0.3
98	0.21
99	0.13
100	0.07
101	0.06
102	0.06
103	0.05
104	0.06
105	0.07
106	0.09
107	0.1
108	0.1
109	0.11
110	0.18
111	0.22
112	0.28
113	0.35
114	0.38
115	0.39
116	0.46
117	0.48
118	0.44
119	0.45
120	0.4
121	0.33
122	0.3
123	0.28
124	0.25
125	0.25
126	0.26
127	0.21
128	0.21
129	0.21
130	0.2
131	0.23
132	0.23
133	0.22
134	0.19
135	0.19
136	0.19
137	0.17
138	0.16
139	0.12
140	0.09
141	0.08
142	0.06
143	0.06
144	0.06
145	0.06
146	0.07
147	0.07
148	0.07
149	0.07
150	0.07
151	0.06
152	0.05
153	0.05
154	0.05
155	0.05
156	0.04
157	0.04
158	0.04
159	0.04
160	0.04
161	0.04
162	0.04
163	0.05
164	0.07
165	0.08
166	0.09
167	0.09
168	0.09
169	0.09
170	0.09
171	0.09
172	0.07
173	0.08
174	0.09
175	0.1
176	0.1
177	0.09
178	0.09
179	0.08
180	0.1
181	0.12
182	0.1
183	0.1
184	0.09
185	0.09
186	0.1
187	0.11
188	0.09
189	0.11
190	0.12
191	0.13
192	0.14
193	0.14
194	0.15
195	0.17
196	0.19
197	0.16
198	0.16
199	0.16
200	0.16
201	0.16
202	0.15
203	0.14
204	0.11
205	0.1
206	0.08
207	0.08
208	0.08
209	0.08
210	0.07
211	0.08
212	0.08
213	0.08
214	0.08
215	0.08
216	0.08
217	0.07
218	0.07
219	0.06
220	0.05
221	0.05
222	0.05
223	0.05
224	0.05
225	0.05
226	0.04
227	0.04
228	0.05
229	0.04
230	0.05
231	0.04
232	0.04
233	0.05
234	0.05
235	0.05
236	0.05
237	0.05
238	0.05
239	0.05
240	0.05
241	0.04
242	0.04
243	0.06
244	0.07
245	0.08
246	0.07
247	0.07
248	0.08
249	0.08
250	0.08
251	0.06
252	0.06
253	0.07
254	0.08
255	0.08
256	0.08
257	0.08
258	0.08
259	0.08
260	0.06
261	0.05
262	0.04
263	0.05
264	0.07
265	0.07
266	0.07
267	0.07
268	0.08
269	0.1
270	0.1
271	0.1
272	0.08
273	0.07
274	0.07
275	0.07
276	0.06
277	0.05
278	0.04
279	0.04
280	0.04
281	0.04
282	0.03
283	0.03
284	0.03
285	0.03
286	0.04
287	0.05
288	0.05
289	0.06
290	0.07
291	0.07
292	0.07
293	0.08
294	0.08
295	0.07
296	0.07
297	0.06
298	0.11
299	0.11
300	0.11
301	0.11
302	0.12
303	0.12
304	0.12
305	0.12
306	0.12
307	0.2
308	0.21
309	0.21
310	0.22
311	0.22
312	0.23
313	0.26
314	0.27
315	0.22
316	0.23
317	0.23
318	0.22
319	0.22
320	0.22
321	0.21
322	0.2
323	0.17
324	0.15
325	0.15
326	0.15
327	0.21
328	0.23
329	0.24
330	0.27
331	0.29
332	0.32
333	0.37
334	0.37
335	0.33
336	0.33
337	0.29
338	0.23
339	0.22
340	0.19
341	0.15
342	0.14
343	0.13
344	0.11
345	0.12
346	0.11
347	0.09
348	0.08
349	0.07
350	0.06
351	0.04
352	0.05
353	0.06
354	0.08
355	0.08
356	0.09
357	0.09
358	0.09
359	0.1
360	0.11
361	0.09
362	0.08
363	0.09
364	0.09
365	0.1
366	0.11
367	0.11
368	0.12
369	0.12
370	0.12
371	0.12
372	0.14
373	0.13
374	0.17
375	0.17
376	0.17
377	0.17
378	0.17
379	0.17
380	0.16
381	0.17
382	0.16
383	0.17
384	0.18
385	0.19
386	0.21
387	0.27
388	0.28
389	0.3
390	0.33
391	0.36
392	0.36
393	0.36
394	0.35
395	0.31
396	0.31
397	0.31
398	0.24
399	0.19
400	0.17
401	0.16
402	0.15
403	0.14
404	0.15
405	0.14
406	0.15
407	0.17
408	0.18
409	0.22
410	0.23
411	0.22
412	0.19
413	0.2
414	0.23
415	0.24
416	0.27
417	0.24
418	0.22
419	0.23
420	0.21
421	0.2
422	0.16
423	0.12
424	0.1
425	0.12
426	0.15
427	0.16
428	0.2
429	0.21
430	0.21
431	0.23
432	0.22
433	0.19
434	0.16
435	0.2
436	0.18
437	0.2
438	0.2
439	0.18
440	0.17
441	0.18
442	0.17
443	0.13
444	0.12
445	0.12
446	0.18
447	0.18
448	0.19
449	0.2
450	0.2
451	0.2
452	0.23
453	0.29
454	0.28
455	0.3
456	0.3
457	0.3
458	0.32
459	0.32

A0A0A2L9S5

3D AlphaFold-predicted Structure Viewer