Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2LB32

Protein Details
Accession A0A0A2LB32    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-27FVIPSLKKWCRKSPRPVLQAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGSSGAFVIPSLKKWCRKSPRPVLQAASHINEVVADGFGGWIGRRRTIQGRKSDAQDENRLVSTRMLGDHHASTVSVVSIIGCPESAGQGEGVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.61
4 0.69
5 0.76
6 0.8
7 0.84
8 0.81
9 0.8
10 0.74
11 0.66
12 0.63
13 0.56
14 0.47
15 0.37
16 0.31
17 0.25
18 0.2
19 0.17
20 0.11
21 0.07
22 0.04
23 0.03
24 0.03
25 0.03
26 0.04
27 0.03
28 0.08
29 0.09
30 0.11
31 0.11
32 0.14
33 0.23
34 0.32
35 0.38
36 0.41
37 0.47
38 0.48
39 0.51
40 0.54
41 0.5
42 0.46
43 0.45
44 0.39
45 0.34
46 0.33
47 0.3
48 0.25
49 0.21
50 0.17
51 0.13
52 0.12
53 0.12
54 0.12
55 0.14
56 0.14
57 0.14
58 0.13
59 0.12
60 0.11
61 0.11
62 0.09
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.08
73 0.08
74 0.08
75 0.08