Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JTA6

Protein Details
Accession C4JTA6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92VNKNCKKLSYRNDKGNHKMTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 5, cyto 3, mito_nucl 3
Family & Domain DBs
KEGG ure:UREG_05695  -  
Amino Acid Sequences MKLSAVTFLSCLALSSAWKLDLYASDKRHVSTHGTRDSGCKNIDFSPALKVNRANFRPATNNWPDPGTFELYVNKNCKKLSYRNDKGNHKMTARTIRSYKVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.11
5 0.11
6 0.11
7 0.11
8 0.15
9 0.19
10 0.23
11 0.24
12 0.28
13 0.29
14 0.3
15 0.3
16 0.28
17 0.3
18 0.31
19 0.36
20 0.37
21 0.38
22 0.37
23 0.4
24 0.41
25 0.37
26 0.31
27 0.24
28 0.21
29 0.2
30 0.23
31 0.2
32 0.18
33 0.19
34 0.23
35 0.23
36 0.22
37 0.23
38 0.24
39 0.31
40 0.32
41 0.3
42 0.27
43 0.29
44 0.32
45 0.32
46 0.35
47 0.33
48 0.34
49 0.31
50 0.31
51 0.28
52 0.25
53 0.26
54 0.22
55 0.17
56 0.16
57 0.2
58 0.22
59 0.28
60 0.32
61 0.32
62 0.32
63 0.32
64 0.36
65 0.38
66 0.44
67 0.49
68 0.54
69 0.6
70 0.66
71 0.75
72 0.79
73 0.81
74 0.79
75 0.75
76 0.66
77 0.63
78 0.61
79 0.63
80 0.59
81 0.58
82 0.54