Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2L933

Protein Details
Accession A0A0A2L933    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
85-104QQKYGFKKKGPKGTPRKKVABasic
NLS Segment(s)
PositionSequence
90-102FKKKGPKGTPRKK
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAPVTNKLNTKGTDTTKTKMKVNIKAPAEGETEVLEEENEPQAPKACDEVFLLTLLDNVKVDHETAAKTLGINKAACRMRFIRLQQKYGFKKKGPKGTPRKKVAALTNKEAADEVEPTPANESNVTEEGETVKGDTVEEPTEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.51
4 0.53
5 0.52
6 0.53
7 0.56
8 0.55
9 0.58
10 0.63
11 0.57
12 0.58
13 0.54
14 0.48
15 0.43
16 0.34
17 0.27
18 0.19
19 0.17
20 0.13
21 0.12
22 0.09
23 0.07
24 0.08
25 0.08
26 0.09
27 0.08
28 0.09
29 0.13
30 0.13
31 0.14
32 0.16
33 0.14
34 0.15
35 0.16
36 0.17
37 0.14
38 0.13
39 0.12
40 0.09
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.09
54 0.08
55 0.08
56 0.1
57 0.11
58 0.13
59 0.13
60 0.12
61 0.19
62 0.22
63 0.22
64 0.23
65 0.23
66 0.24
67 0.29
68 0.34
69 0.37
70 0.38
71 0.43
72 0.44
73 0.52
74 0.56
75 0.6
76 0.61
77 0.55
78 0.61
79 0.64
80 0.69
81 0.67
82 0.7
83 0.72
84 0.77
85 0.82
86 0.8
87 0.78
88 0.72
89 0.7
90 0.69
91 0.68
92 0.63
93 0.58
94 0.57
95 0.52
96 0.47
97 0.42
98 0.33
99 0.24
100 0.21
101 0.16
102 0.14
103 0.14
104 0.15
105 0.17
106 0.18
107 0.17
108 0.16
109 0.17
110 0.17
111 0.19
112 0.2
113 0.17
114 0.16
115 0.16
116 0.16
117 0.15
118 0.11
119 0.11
120 0.1
121 0.11
122 0.11
123 0.13