Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2L6W6

Protein Details
Accession A0A0A2L6W6    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-77WIEGRVTKKRKSQRRVVNCRVQRSNMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.333, cyto 9, nucl 8.5, mito 8, cyto_pero 5.333
Family & Domain DBs
Amino Acid Sequences MPRSKTDGLHRPSNIHLNTGAPPNSVGMWVDCCCNSGFRHRSEILSVQVFRWIEGRVTKKRKSQRRVVNCRVQRSNMSSGKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.35
4 0.29
5 0.29
6 0.31
7 0.28
8 0.19
9 0.19
10 0.17
11 0.17
12 0.15
13 0.13
14 0.08
15 0.1
16 0.1
17 0.11
18 0.1
19 0.11
20 0.11
21 0.13
22 0.13
23 0.19
24 0.23
25 0.23
26 0.29
27 0.29
28 0.29
29 0.29
30 0.31
31 0.24
32 0.23
33 0.22
34 0.16
35 0.19
36 0.18
37 0.17
38 0.16
39 0.14
40 0.12
41 0.18
42 0.25
43 0.31
44 0.39
45 0.45
46 0.52
47 0.62
48 0.7
49 0.73
50 0.76
51 0.78
52 0.81
53 0.86
54 0.87
55 0.88
56 0.85
57 0.86
58 0.82
59 0.75
60 0.7
61 0.66
62 0.66
63 0.61