Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2KGK4

Protein Details
Accession A0A0A2KGK4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-43LLKLSHPKTKAKRGRNTNQSPWVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 9, plas 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MILLCLFALTSTAIPAGYSLLKLSHPKTKAKRGRNTNQSPWVSTIEECTRERKSWLNGCQLAVSSVSASPTTPYTLVGWMNTGMVRYMDSLQTRPAGSNPVPILRRKTAALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.08
6 0.08
7 0.09
8 0.11
9 0.16
10 0.19
11 0.25
12 0.28
13 0.37
14 0.44
15 0.54
16 0.61
17 0.67
18 0.74
19 0.76
20 0.83
21 0.85
22 0.85
23 0.82
24 0.82
25 0.74
26 0.66
27 0.58
28 0.5
29 0.41
30 0.32
31 0.28
32 0.22
33 0.24
34 0.23
35 0.24
36 0.24
37 0.24
38 0.26
39 0.26
40 0.29
41 0.33
42 0.37
43 0.41
44 0.39
45 0.39
46 0.37
47 0.33
48 0.27
49 0.2
50 0.15
51 0.07
52 0.06
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.09
61 0.09
62 0.11
63 0.12
64 0.11
65 0.11
66 0.1
67 0.11
68 0.1
69 0.09
70 0.07
71 0.07
72 0.08
73 0.08
74 0.09
75 0.13
76 0.15
77 0.16
78 0.17
79 0.2
80 0.2
81 0.19
82 0.19
83 0.22
84 0.21
85 0.27
86 0.27
87 0.32
88 0.34
89 0.38
90 0.44
91 0.42
92 0.44