Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2L567

Protein Details
Accession A0A0A2L567   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-34PTNSSQRSSSKRRLMRQKQCRRKSNLMKKACEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAPTNSSQRSSSKRRLMRQKQCRRKSNLMKKACEYSRMCEADVCLGIRLRETGQVFILSADASGFWGFLGSQLVCCQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.79
3 0.83
4 0.86
5 0.88
6 0.9
7 0.91
8 0.92
9 0.92
10 0.9
11 0.89
12 0.9
13 0.9
14 0.88
15 0.85
16 0.8
17 0.73
18 0.72
19 0.62
20 0.58
21 0.49
22 0.42
23 0.42
24 0.39
25 0.36
26 0.28
27 0.27
28 0.21
29 0.2
30 0.17
31 0.1
32 0.09
33 0.09
34 0.09
35 0.1
36 0.09
37 0.13
38 0.13
39 0.14
40 0.14
41 0.14
42 0.14
43 0.13
44 0.13
45 0.08
46 0.07
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.09
57 0.09
58 0.1