Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KUV2

Protein Details
Accession A0A0A2KUV2    Localization Confidence High Confidence Score 22.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-119LAKAQASMREKKRKEKRTPKDDTASSHydrophilic
136-159LEAASKTKTKEKKRTSKHAPMEQSHydrophilic
298-327GSRERAKALERRRKKMTSKERKEMPWERRGBasic
NLS Segment(s)
PositionSequence
102-112REKKRKEKRTP
133-168EQKLEAASKTKTKEKKRTSKHAPMEQSSKRAVTRKR
231-274KEKLKGEIRRAQDKLRSAQNKKREADVQAEHKKREKQLIREGKK
300-346RERAKALERRRKKMTSKERKEMPWERRGAEGGGGQDGGMPNGGKRRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MAITDLLNRRVRARPEDDEVLSEASGSEDGSQDGSDAESNGSIQSPADDSEAEGTGKDSESEASDSDIEEEPESEHDSGDDFKASLADISFGALAKAQASMREKKRKEKRTPKDDTASSTLDDIRTKLREAREQKLEAASKTKTKEKKRTSKHAPMEQSSKRAVTRKRTAVELPPAPRSRDPRFDAAVMGHSGVGKHPHGGTAYAFLDEYRASELNDLKEQMRKTKNLQQKEKLKGEIRRAQDKLRSAQNKKREADVQAEHKKREKQLIREGKKATPYYLKNSELQKQVLERKYEEMGSRERAKALERRRKKMTSKERKEMPWERRGAEGGGGQDGGMPNGGKRRRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.59
4 0.56
5 0.51
6 0.46
7 0.4
8 0.32
9 0.25
10 0.18
11 0.13
12 0.11
13 0.09
14 0.08
15 0.07
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.08
30 0.07
31 0.08
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.12
38 0.13
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.09
46 0.09
47 0.11
48 0.12
49 0.11
50 0.12
51 0.12
52 0.12
53 0.14
54 0.14
55 0.13
56 0.12
57 0.12
58 0.11
59 0.12
60 0.15
61 0.12
62 0.11
63 0.1
64 0.11
65 0.12
66 0.12
67 0.11
68 0.08
69 0.08
70 0.09
71 0.09
72 0.08
73 0.07
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.08
84 0.07
85 0.12
86 0.17
87 0.25
88 0.34
89 0.45
90 0.48
91 0.57
92 0.68
93 0.74
94 0.8
95 0.83
96 0.85
97 0.85
98 0.9
99 0.88
100 0.85
101 0.77
102 0.71
103 0.64
104 0.55
105 0.44
106 0.37
107 0.3
108 0.23
109 0.21
110 0.17
111 0.16
112 0.15
113 0.16
114 0.2
115 0.22
116 0.3
117 0.34
118 0.4
119 0.43
120 0.44
121 0.44
122 0.45
123 0.43
124 0.36
125 0.35
126 0.3
127 0.27
128 0.29
129 0.35
130 0.38
131 0.45
132 0.55
133 0.61
134 0.69
135 0.74
136 0.81
137 0.84
138 0.86
139 0.85
140 0.82
141 0.77
142 0.7
143 0.7
144 0.62
145 0.55
146 0.46
147 0.4
148 0.34
149 0.36
150 0.37
151 0.38
152 0.44
153 0.47
154 0.46
155 0.47
156 0.47
157 0.46
158 0.47
159 0.43
160 0.37
161 0.37
162 0.37
163 0.37
164 0.38
165 0.39
166 0.37
167 0.4
168 0.4
169 0.38
170 0.38
171 0.36
172 0.34
173 0.28
174 0.25
175 0.17
176 0.14
177 0.1
178 0.08
179 0.08
180 0.08
181 0.1
182 0.08
183 0.09
184 0.09
185 0.1
186 0.1
187 0.11
188 0.11
189 0.12
190 0.12
191 0.11
192 0.11
193 0.09
194 0.1
195 0.09
196 0.09
197 0.08
198 0.08
199 0.08
200 0.11
201 0.13
202 0.15
203 0.16
204 0.17
205 0.16
206 0.2
207 0.21
208 0.27
209 0.3
210 0.31
211 0.35
212 0.43
213 0.51
214 0.56
215 0.64
216 0.65
217 0.69
218 0.75
219 0.74
220 0.72
221 0.7
222 0.67
223 0.67
224 0.65
225 0.61
226 0.61
227 0.59
228 0.57
229 0.56
230 0.55
231 0.51
232 0.53
233 0.57
234 0.56
235 0.62
236 0.66
237 0.69
238 0.65
239 0.65
240 0.6
241 0.53
242 0.53
243 0.51
244 0.52
245 0.53
246 0.57
247 0.55
248 0.57
249 0.6
250 0.57
251 0.61
252 0.59
253 0.57
254 0.63
255 0.71
256 0.71
257 0.73
258 0.72
259 0.66
260 0.66
261 0.59
262 0.53
263 0.51
264 0.49
265 0.49
266 0.52
267 0.5
268 0.48
269 0.51
270 0.54
271 0.5
272 0.47
273 0.43
274 0.42
275 0.49
276 0.49
277 0.48
278 0.42
279 0.41
280 0.42
281 0.42
282 0.38
283 0.33
284 0.33
285 0.36
286 0.4
287 0.38
288 0.37
289 0.35
290 0.37
291 0.42
292 0.47
293 0.52
294 0.56
295 0.62
296 0.7
297 0.77
298 0.81
299 0.83
300 0.83
301 0.84
302 0.85
303 0.86
304 0.86
305 0.84
306 0.85
307 0.84
308 0.82
309 0.79
310 0.75
311 0.67
312 0.62
313 0.58
314 0.49
315 0.42
316 0.36
317 0.28
318 0.24
319 0.22
320 0.18
321 0.18
322 0.16
323 0.14
324 0.13
325 0.11
326 0.12
327 0.21
328 0.26