Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2L964

Protein Details
Accession A0A0A2L964    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-107KGRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFSLRSVFGASSGAFRQFLPSVTTRTASSRPFSHMIFNSLTRLRGQVKSGNAVAVANVSARQVEQVRGMKTRSSVKRLCDGCKPVHRKGRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.17
5 0.18
6 0.19
7 0.19
8 0.22
9 0.23
10 0.24
11 0.22
12 0.25
13 0.28
14 0.26
15 0.28
16 0.26
17 0.29
18 0.31
19 0.3
20 0.32
21 0.29
22 0.29
23 0.28
24 0.26
25 0.25
26 0.23
27 0.23
28 0.18
29 0.19
30 0.2
31 0.19
32 0.21
33 0.22
34 0.22
35 0.24
36 0.24
37 0.21
38 0.18
39 0.16
40 0.13
41 0.09
42 0.07
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.06
49 0.07
50 0.08
51 0.13
52 0.18
53 0.2
54 0.22
55 0.23
56 0.23
57 0.25
58 0.34
59 0.34
60 0.37
61 0.39
62 0.4
63 0.48
64 0.5
65 0.51
66 0.5
67 0.49
68 0.5
69 0.56
70 0.59
71 0.6
72 0.65
73 0.67
74 0.63
75 0.64
76 0.68
77 0.63
78 0.61
79 0.62
80 0.6
81 0.63
82 0.66
83 0.66
84 0.66
85 0.71
86 0.77
87 0.78