Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2L7V6

Protein Details
Accession A0A0A2L7V6    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-46LKGSKLSGGRIEKKKKKSTKKKEGEETQPKPEBasic
NLS Segment(s)
PositionSequence
11-37GKLKLKGSKLSGGRIEKKKKKSTKKKE
80-98AERKAEEVRRKRLRERLQR
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAGDEYSIGGGKLKLKGSKLSGGRIEKKKKKSTKKKEGEETQPKPESTLGTERPETENDEGVRSEGDRKKEWDMPGKTEAERKAEEVRRKRLRERLQRDGVKTHKERVEELNKYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.32
4 0.35
5 0.42
6 0.41
7 0.43
8 0.47
9 0.51
10 0.58
11 0.62
12 0.69
13 0.7
14 0.76
15 0.8
16 0.83
17 0.86
18 0.88
19 0.9
20 0.9
21 0.92
22 0.92
23 0.92
24 0.9
25 0.89
26 0.89
27 0.82
28 0.79
29 0.73
30 0.63
31 0.54
32 0.46
33 0.36
34 0.29
35 0.31
36 0.26
37 0.26
38 0.27
39 0.27
40 0.28
41 0.27
42 0.27
43 0.21
44 0.21
45 0.18
46 0.18
47 0.17
48 0.15
49 0.14
50 0.11
51 0.17
52 0.16
53 0.19
54 0.2
55 0.23
56 0.26
57 0.31
58 0.34
59 0.36
60 0.36
61 0.37
62 0.39
63 0.39
64 0.35
65 0.36
66 0.35
67 0.29
68 0.28
69 0.26
70 0.3
71 0.35
72 0.43
73 0.46
74 0.55
75 0.6
76 0.65
77 0.7
78 0.71
79 0.75
80 0.77
81 0.78
82 0.78
83 0.78
84 0.79
85 0.76
86 0.74
87 0.69
88 0.68
89 0.63
90 0.6
91 0.54
92 0.5
93 0.49
94 0.5
95 0.54
96 0.48
97 0.48
98 0.5
99 0.46
100 0.46
101 0.44
102 0.37
103 0.31
104 0.28
105 0.31
106 0.3
107 0.32
108 0.38
109 0.42
110 0.42