Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KKU0

Protein Details
Accession A0A0A2KKU0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
10-38LSHRHRSFKGCWTCKKRRVQCDEMRPACRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPSTDKQKDLSHRHRSFKGCWTCKKRRVQCDEMRPACRKCSDRGLTCEGYEIRLRWGAGIASRGKFSGAEKPVKESITPRAKRRWDMRDKGDRYSSGDGDGQPVLVSQPLVEGIVATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.71
4 0.71
5 0.71
6 0.69
7 0.71
8 0.74
9 0.77
10 0.8
11 0.86
12 0.85
13 0.85
14 0.85
15 0.85
16 0.84
17 0.84
18 0.86
19 0.82
20 0.79
21 0.75
22 0.67
23 0.62
24 0.58
25 0.5
26 0.43
27 0.47
28 0.48
29 0.47
30 0.5
31 0.52
32 0.47
33 0.44
34 0.43
35 0.33
36 0.28
37 0.24
38 0.19
39 0.14
40 0.15
41 0.14
42 0.11
43 0.12
44 0.1
45 0.09
46 0.12
47 0.13
48 0.12
49 0.12
50 0.12
51 0.12
52 0.12
53 0.12
54 0.17
55 0.2
56 0.25
57 0.25
58 0.29
59 0.32
60 0.32
61 0.31
62 0.26
63 0.31
64 0.36
65 0.41
66 0.41
67 0.48
68 0.52
69 0.59
70 0.66
71 0.67
72 0.67
73 0.7
74 0.75
75 0.77
76 0.75
77 0.73
78 0.69
79 0.6
80 0.55
81 0.51
82 0.42
83 0.34
84 0.33
85 0.28
86 0.25
87 0.24
88 0.18
89 0.13
90 0.13
91 0.1
92 0.09
93 0.08
94 0.05
95 0.06
96 0.07
97 0.07
98 0.07