Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2K9N3

Protein Details
Accession A0A0A2K9N3   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-45EKTAPTTRSENNNKQHRKKTKTKNKKQTKNPTIKKHHAKKSQDHydrophilic
NLS Segment(s)
PositionSequence
16-51KQHRKKTKTKNKKQTKNPTIKKHHAKKSQDGEGERK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEEKTAPTTRSENNNKQHRKKTKTKNKKQTKNPTIKKHHAKKSQDGEGERKKSEIFDNANPPAPSNPMHQNRRIPYTNAYQRISTNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.81
4 0.86
5 0.86
6 0.85
7 0.86
8 0.88
9 0.89
10 0.9
11 0.92
12 0.92
13 0.93
14 0.94
15 0.95
16 0.95
17 0.94
18 0.93
19 0.92
20 0.91
21 0.89
22 0.89
23 0.88
24 0.86
25 0.85
26 0.84
27 0.8
28 0.78
29 0.75
30 0.72
31 0.66
32 0.59
33 0.57
34 0.56
35 0.55
36 0.46
37 0.4
38 0.34
39 0.31
40 0.3
41 0.29
42 0.25
43 0.27
44 0.33
45 0.34
46 0.39
47 0.38
48 0.36
49 0.31
50 0.28
51 0.24
52 0.22
53 0.3
54 0.35
55 0.41
56 0.46
57 0.54
58 0.56
59 0.62
60 0.62
61 0.55
62 0.51
63 0.56
64 0.59
65 0.58
66 0.56
67 0.5