Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2L972

Protein Details
Accession A0A0A2L972    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-86VVTEKYFQQKKGRKKGEKKIPWWQFWAHydrophilic
NLS Segment(s)
PositionSequence
69-80KKGRKKGEKKIP
Subcellular Location(s) mito 8, plas 6, E.R. 5, extr 3, pero 2, cyto 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATNGTYPVYPRLFRGSNAWKSRLVAGGCGLGGLALVLGIVIWIVWFHTQQTQLKDPQRVVTEKYFQQKKGRKKGEKKIPWWQFWAKKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.41
4 0.46
5 0.51
6 0.52
7 0.46
8 0.46
9 0.47
10 0.43
11 0.34
12 0.25
13 0.21
14 0.19
15 0.17
16 0.15
17 0.12
18 0.06
19 0.06
20 0.04
21 0.03
22 0.02
23 0.01
24 0.01
25 0.01
26 0.01
27 0.01
28 0.01
29 0.01
30 0.01
31 0.02
32 0.03
33 0.03
34 0.04
35 0.07
36 0.11
37 0.14
38 0.19
39 0.22
40 0.28
41 0.33
42 0.36
43 0.35
44 0.35
45 0.36
46 0.34
47 0.35
48 0.34
49 0.34
50 0.35
51 0.44
52 0.45
53 0.46
54 0.54
55 0.59
56 0.64
57 0.7
58 0.76
59 0.77
60 0.82
61 0.89
62 0.9
63 0.91
64 0.89
65 0.89
66 0.87
67 0.82
68 0.79
69 0.78
70 0.74