Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2L4M6

Protein Details
Accession A0A0A2L4M6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-47ESEKREGEKGKRKERKTWRRVRENKWQRKQINBasic
NLS Segment(s)
PositionSequence
5-42KARLKNQAVDKESEKREGEKGKRKERKTWRRVRENKWQ
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MRKEKARLKNQAVDKESEKREGEKGKRKERKTWRRVRENKWQRKQINTTHVCTVQGLRIRTVPGHQKPSFLSKTIMNRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.56
4 0.53
5 0.46
6 0.39
7 0.42
8 0.47
9 0.52
10 0.53
11 0.6
12 0.65
13 0.73
14 0.75
15 0.78
16 0.8
17 0.82
18 0.83
19 0.84
20 0.83
21 0.85
22 0.9
23 0.87
24 0.87
25 0.87
26 0.87
27 0.85
28 0.84
29 0.76
30 0.75
31 0.75
32 0.71
33 0.7
34 0.64
35 0.58
36 0.52
37 0.49
38 0.42
39 0.36
40 0.3
41 0.24
42 0.25
43 0.23
44 0.2
45 0.21
46 0.22
47 0.22
48 0.26
49 0.32
50 0.34
51 0.43
52 0.42
53 0.43
54 0.45
55 0.53
56 0.51
57 0.43
58 0.38
59 0.36