Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JRN5

Protein Details
Accession C4JRN5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-190TPSPSTQATKPRRSKLRPRKAAMILHydrophilic
NLS Segment(s)
PositionSequence
175-185KPRRSKLRPRK
Subcellular Location(s) nucl 11, extr 9, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000361  FeS_biogenesis  
IPR035903  HesB-like_dom_sf  
KEGG ure:UREG_05124  -  
Pfam View protein in Pfam  
PF01521  Fe-S_biosyn  
Amino Acid Sequences MIGATFCRGVSANLGFDTIVSAGLVSLAAGLEIHLLSANLSPAMSFIHNPVTSSIRLFFRDASRRGCTQTARPFSSCRQAYQSSKRELQTATAYRPQTLVEPFPPRNAGTPDTSISKAIPSSRGADLSPDPLNTKGTDRFKSYSLPEAEAQKSRSFSSPDFTPATTPSPSTQATKPRRSKLRPRKAAMILTPAAISQLRNLLSQPDPKMIRVGVKNRGCSGLSYNLEFVEKPAPFDEVVEQDGNQSPRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.16
5 0.11
6 0.09
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.06
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.08
31 0.09
32 0.08
33 0.1
34 0.17
35 0.17
36 0.18
37 0.2
38 0.21
39 0.21
40 0.22
41 0.23
42 0.19
43 0.21
44 0.22
45 0.23
46 0.27
47 0.35
48 0.37
49 0.39
50 0.41
51 0.41
52 0.43
53 0.44
54 0.4
55 0.4
56 0.46
57 0.48
58 0.48
59 0.48
60 0.48
61 0.47
62 0.53
63 0.46
64 0.39
65 0.37
66 0.39
67 0.44
68 0.51
69 0.55
70 0.51
71 0.55
72 0.53
73 0.5
74 0.45
75 0.4
76 0.38
77 0.34
78 0.33
79 0.34
80 0.33
81 0.31
82 0.31
83 0.28
84 0.22
85 0.21
86 0.19
87 0.17
88 0.24
89 0.24
90 0.25
91 0.26
92 0.24
93 0.25
94 0.25
95 0.23
96 0.19
97 0.2
98 0.2
99 0.21
100 0.21
101 0.19
102 0.16
103 0.14
104 0.13
105 0.12
106 0.12
107 0.11
108 0.13
109 0.14
110 0.14
111 0.14
112 0.15
113 0.14
114 0.15
115 0.15
116 0.12
117 0.13
118 0.13
119 0.14
120 0.12
121 0.14
122 0.18
123 0.22
124 0.24
125 0.27
126 0.28
127 0.28
128 0.31
129 0.3
130 0.3
131 0.27
132 0.27
133 0.25
134 0.28
135 0.29
136 0.29
137 0.29
138 0.24
139 0.24
140 0.23
141 0.24
142 0.23
143 0.21
144 0.22
145 0.21
146 0.23
147 0.23
148 0.22
149 0.21
150 0.2
151 0.22
152 0.19
153 0.19
154 0.16
155 0.18
156 0.19
157 0.21
158 0.24
159 0.31
160 0.39
161 0.48
162 0.55
163 0.6
164 0.69
165 0.74
166 0.81
167 0.83
168 0.85
169 0.85
170 0.82
171 0.82
172 0.78
173 0.76
174 0.67
175 0.62
176 0.51
177 0.41
178 0.36
179 0.27
180 0.22
181 0.17
182 0.14
183 0.09
184 0.13
185 0.13
186 0.14
187 0.14
188 0.17
189 0.2
190 0.26
191 0.28
192 0.31
193 0.31
194 0.31
195 0.34
196 0.31
197 0.35
198 0.36
199 0.41
200 0.43
201 0.48
202 0.51
203 0.49
204 0.51
205 0.45
206 0.39
207 0.37
208 0.36
209 0.33
210 0.32
211 0.31
212 0.28
213 0.28
214 0.26
215 0.23
216 0.22
217 0.19
218 0.2
219 0.2
220 0.21
221 0.2
222 0.22
223 0.23
224 0.18
225 0.22
226 0.21
227 0.2
228 0.2
229 0.26
230 0.28