Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JQZ6

Protein Details
Accession C4JQZ6   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-39LAYPSPFGREKGKKKRKKWHPLTKKKVAGVBasic
NLS Segment(s)
PositionSequence
18-35REKGKKKRKKWHPLTKKK
Subcellular Location(s) mito 17.5, mito_nucl 13.333, nucl 8, cyto_nucl 5.333
Family & Domain DBs
KEGG ure:UREG_03478  -  
Amino Acid Sequences MAPISPPNTLAYPSPFGREKGKKKRKKWHPLTKKKVAGVPSATFPLHQAYYYSTFALQRLLFFPRSVSRKELSRQHRLCYLARPIKEWAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.37
5 0.44
6 0.5
7 0.57
8 0.67
9 0.72
10 0.8
11 0.89
12 0.91
13 0.92
14 0.93
15 0.93
16 0.93
17 0.94
18 0.94
19 0.93
20 0.88
21 0.79
22 0.72
23 0.63
24 0.56
25 0.49
26 0.4
27 0.31
28 0.27
29 0.24
30 0.2
31 0.18
32 0.16
33 0.12
34 0.1
35 0.09
36 0.1
37 0.14
38 0.15
39 0.14
40 0.13
41 0.14
42 0.14
43 0.17
44 0.14
45 0.11
46 0.12
47 0.15
48 0.15
49 0.15
50 0.17
51 0.21
52 0.24
53 0.26
54 0.29
55 0.28
56 0.33
57 0.4
58 0.47
59 0.48
60 0.56
61 0.57
62 0.57
63 0.6
64 0.58
65 0.54
66 0.52
67 0.55
68 0.52
69 0.5
70 0.49