Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2LDA2

Protein Details
Accession A0A0A2LDA2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-91RPPIARSSTSSRRRRDRRRPSGTYVDYHydrophilic
NLS Segment(s)
PositionSequence
76-83RRRRDRRR
Subcellular Location(s) extr 8, cyto 6, nucl 4, mito 3, plas 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPINSVLEPRQSSGDNCPSTISGGGIAGIVIGSIAGTLLSLWLWRIFRLPGAWSGGDTSDVGYRPPIARSSTSSRRRRDRRRPSGTYVDYVEKPTSVRTARRYRDRDDLRRPAKVYMTEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.34
4 0.32
5 0.32
6 0.3
7 0.29
8 0.28
9 0.2
10 0.11
11 0.1
12 0.09
13 0.07
14 0.07
15 0.05
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.06
31 0.06
32 0.07
33 0.08
34 0.09
35 0.1
36 0.11
37 0.12
38 0.11
39 0.14
40 0.13
41 0.12
42 0.12
43 0.11
44 0.11
45 0.1
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.09
54 0.11
55 0.11
56 0.13
57 0.17
58 0.25
59 0.34
60 0.44
61 0.51
62 0.57
63 0.65
64 0.75
65 0.81
66 0.84
67 0.86
68 0.87
69 0.89
70 0.88
71 0.85
72 0.84
73 0.76
74 0.68
75 0.6
76 0.54
77 0.45
78 0.41
79 0.34
80 0.24
81 0.22
82 0.2
83 0.23
84 0.23
85 0.28
86 0.34
87 0.44
88 0.52
89 0.62
90 0.66
91 0.65
92 0.72
93 0.76
94 0.77
95 0.78
96 0.79
97 0.75
98 0.77
99 0.74
100 0.68
101 0.64