Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KMG6

Protein Details
Accession A0A0A2KMG6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-24RHEEPCPRTRNKWNKPLFRISKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 5, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences MRHEEPCPRTRNKWNKPLFRISKAWNGDQLYAMLCYRKANSEAIRIQVVGSELDDEECCSSYIKTHDPFLACVRVPKSPDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.83
4 0.86
5 0.82
6 0.77
7 0.73
8 0.67
9 0.66
10 0.59
11 0.54
12 0.49
13 0.43
14 0.38
15 0.32
16 0.28
17 0.2
18 0.17
19 0.15
20 0.1
21 0.09
22 0.09
23 0.09
24 0.11
25 0.11
26 0.14
27 0.16
28 0.21
29 0.22
30 0.23
31 0.23
32 0.21
33 0.19
34 0.16
35 0.15
36 0.09
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.11
49 0.15
50 0.2
51 0.22
52 0.24
53 0.28
54 0.28
55 0.31
56 0.32
57 0.34
58 0.29
59 0.32
60 0.32
61 0.33
62 0.35