Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2LPI2

Protein Details
Accession A0A0A2LPI2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTRTRKVSKKTYLRNYRRPNCFVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MTRTRKVSKKTYLRNYRRPNCFVGTLIYSKRIINDINQKAEAMWEWASLVLRSVNHRIPDSTKQQAYILFIKDCRGIFLWLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.91
4 0.88
5 0.82
6 0.76
7 0.68
8 0.6
9 0.51
10 0.43
11 0.37
12 0.32
13 0.29
14 0.26
15 0.23
16 0.21
17 0.21
18 0.19
19 0.16
20 0.18
21 0.27
22 0.29
23 0.31
24 0.31
25 0.3
26 0.28
27 0.27
28 0.22
29 0.14
30 0.1
31 0.07
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.1
40 0.15
41 0.18
42 0.2
43 0.21
44 0.22
45 0.26
46 0.32
47 0.36
48 0.39
49 0.37
50 0.36
51 0.37
52 0.36
53 0.36
54 0.33
55 0.3
56 0.25
57 0.25
58 0.26
59 0.28
60 0.27
61 0.25
62 0.23
63 0.22