Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2L5B3

Protein Details
Accession A0A0A2L5B3   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGNAKGRNKGKGRGKKRSHSLNESKIAHydrophilic
NLS Segment(s)
PositionSequence
5-46KGRNKGKGRGKKRSHSLNESKIATKVENKAVVKPKGEKKGKH
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGNAKGRNKGKGRGKKRSHSLNESKIATKVENKAVVKPKGEKKGKHHCPEKHVRTPRCIRLGHVVKCPIHPESYPRRLDECVKCVNADKRLVQQEQKDRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.87
4 0.88
5 0.86
6 0.85
7 0.84
8 0.81
9 0.79
10 0.72
11 0.64
12 0.55
13 0.48
14 0.4
15 0.35
16 0.31
17 0.3
18 0.34
19 0.33
20 0.38
21 0.44
22 0.46
23 0.44
24 0.47
25 0.49
26 0.53
27 0.59
28 0.57
29 0.58
30 0.66
31 0.72
32 0.74
33 0.75
34 0.7
35 0.71
36 0.76
37 0.76
38 0.74
39 0.74
40 0.68
41 0.67
42 0.7
43 0.68
44 0.64
45 0.56
46 0.49
47 0.5
48 0.55
49 0.51
50 0.49
51 0.48
52 0.42
53 0.43
54 0.44
55 0.35
56 0.29
57 0.26
58 0.28
59 0.32
60 0.4
61 0.41
62 0.41
63 0.42
64 0.43
65 0.51
66 0.5
67 0.46
68 0.44
69 0.42
70 0.41
71 0.45
72 0.49
73 0.46
74 0.45
75 0.43
76 0.44
77 0.5
78 0.55
79 0.54
80 0.56
81 0.61