Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VUK8

Protein Details
Accession A0A098VUK8    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-56QNIPKRCSIKTKRSKFSYGCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, mito 9, nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR024951  Sulfurylase_cat_dom  
Gene Ontology GO:0004781  F:sulfate adenylyltransferase (ATP) activity  
Pfam View protein in Pfam  
PF01747  ATP-sulfurylase  
Amino Acid Sequences MEIAGRGGAFLDAIMRKNYACTKFIVERDHMQDLGEQNIPKRCSIKTKRSKFSYGCDILGNLQSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.17
5 0.23
6 0.23
7 0.22
8 0.23
9 0.27
10 0.31
11 0.35
12 0.35
13 0.32
14 0.32
15 0.35
16 0.35
17 0.29
18 0.24
19 0.22
20 0.19
21 0.19
22 0.18
23 0.14
24 0.15
25 0.2
26 0.21
27 0.2
28 0.22
29 0.21
30 0.3
31 0.38
32 0.47
33 0.52
34 0.62
35 0.7
36 0.74
37 0.81
38 0.74
39 0.72
40 0.71
41 0.64
42 0.56
43 0.47
44 0.42
45 0.37