Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VRN6

Protein Details
Accession A0A098VRN6   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-35SRIACHRLKVWRKENHAQLECHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001853  DSBA-like_thioredoxin_dom  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF01323  DSBA  
Amino Acid Sequences MAKLEFYFDLASPYSRIACHRLKVWRKENHAQLECIPVSLTAILKDSSGETALQHKKRMHSLVDLKRAACLYEISDFDTSSSRIQANLKSKEIRLKMIELANRGITFDDLELLYKKYWSFSCTEQKDPITCNQDATKKQTFSSEGQVKLLENTKKAIEMGAFGLPWFRLFRSGRDAQAYFGSDRLEHISLDVQENIANKSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.23
5 0.28
6 0.3
7 0.36
8 0.45
9 0.53
10 0.62
11 0.69
12 0.71
13 0.73
14 0.79
15 0.81
16 0.81
17 0.75
18 0.67
19 0.59
20 0.57
21 0.48
22 0.39
23 0.31
24 0.2
25 0.17
26 0.16
27 0.15
28 0.08
29 0.1
30 0.09
31 0.09
32 0.1
33 0.09
34 0.09
35 0.1
36 0.09
37 0.08
38 0.17
39 0.26
40 0.28
41 0.34
42 0.36
43 0.38
44 0.44
45 0.47
46 0.41
47 0.41
48 0.48
49 0.51
50 0.56
51 0.55
52 0.49
53 0.47
54 0.44
55 0.36
56 0.26
57 0.19
58 0.11
59 0.12
60 0.13
61 0.13
62 0.14
63 0.13
64 0.13
65 0.14
66 0.13
67 0.11
68 0.12
69 0.1
70 0.11
71 0.13
72 0.18
73 0.25
74 0.28
75 0.31
76 0.31
77 0.32
78 0.38
79 0.37
80 0.35
81 0.28
82 0.26
83 0.26
84 0.27
85 0.28
86 0.22
87 0.22
88 0.19
89 0.18
90 0.16
91 0.13
92 0.09
93 0.08
94 0.06
95 0.06
96 0.05
97 0.06
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.1
104 0.11
105 0.11
106 0.13
107 0.18
108 0.28
109 0.31
110 0.34
111 0.36
112 0.37
113 0.37
114 0.37
115 0.37
116 0.33
117 0.29
118 0.28
119 0.29
120 0.33
121 0.34
122 0.39
123 0.4
124 0.36
125 0.36
126 0.37
127 0.37
128 0.33
129 0.4
130 0.39
131 0.33
132 0.33
133 0.34
134 0.3
135 0.29
136 0.33
137 0.26
138 0.21
139 0.22
140 0.22
141 0.22
142 0.22
143 0.2
144 0.13
145 0.12
146 0.13
147 0.12
148 0.11
149 0.1
150 0.12
151 0.1
152 0.11
153 0.11
154 0.1
155 0.16
156 0.18
157 0.22
158 0.29
159 0.33
160 0.35
161 0.4
162 0.4
163 0.35
164 0.37
165 0.36
166 0.29
167 0.26
168 0.24
169 0.17
170 0.19
171 0.22
172 0.19
173 0.16
174 0.16
175 0.19
176 0.2
177 0.23
178 0.21
179 0.17
180 0.18
181 0.2
182 0.22