Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JEI8

Protein Details
Accession C4JEI8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
233-254LGFFLARRYQQKKRIRLHELSVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046936  BIM1-like  
IPR046530  BIM1-like_dom  
Gene Ontology GO:0016020  C:membrane  
KEGG ure:UREG_00827  -  
Pfam View protein in Pfam  
PF20238  DUF6595  
CDD cd21176  LPMO_auxiliary-like  
Amino Acid Sequences MRLSQSILLFVASSLPFAAGQSTHGDDESDKMGPVAFMWPPDREWGAAEDNTAPCGSAQGVTNRTDFPLLNGALALIIQDDSWNVHVSISYKDDPKLNDDFELLIEPKRIDSLEPGHECYPLPSPPRDIEEGANATLQLKYLSEFDSKETETFYACADIKFVAASKFTKQIPCFNVTSDDFVAPSPSSTSSSTPSKETSNSDSVSSKGSNGLSGGGIAGVVVGIVAGLALIGLGFFLARRYQQKKRIRLHELSVRSVKWDDVGNRTASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.11
6 0.07
7 0.09
8 0.12
9 0.15
10 0.15
11 0.15
12 0.16
13 0.14
14 0.17
15 0.18
16 0.15
17 0.12
18 0.11
19 0.12
20 0.11
21 0.11
22 0.12
23 0.1
24 0.13
25 0.15
26 0.16
27 0.17
28 0.21
29 0.21
30 0.19
31 0.19
32 0.19
33 0.21
34 0.2
35 0.21
36 0.21
37 0.2
38 0.21
39 0.19
40 0.16
41 0.11
42 0.12
43 0.11
44 0.08
45 0.11
46 0.15
47 0.18
48 0.2
49 0.22
50 0.21
51 0.21
52 0.22
53 0.19
54 0.16
55 0.19
56 0.17
57 0.16
58 0.15
59 0.14
60 0.12
61 0.12
62 0.09
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.08
74 0.1
75 0.12
76 0.15
77 0.17
78 0.17
79 0.19
80 0.22
81 0.22
82 0.25
83 0.26
84 0.22
85 0.2
86 0.19
87 0.18
88 0.16
89 0.17
90 0.13
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.1
97 0.08
98 0.1
99 0.13
100 0.19
101 0.21
102 0.24
103 0.23
104 0.24
105 0.23
106 0.22
107 0.21
108 0.17
109 0.18
110 0.16
111 0.18
112 0.19
113 0.22
114 0.22
115 0.21
116 0.18
117 0.19
118 0.19
119 0.17
120 0.15
121 0.12
122 0.11
123 0.09
124 0.09
125 0.06
126 0.05
127 0.05
128 0.06
129 0.08
130 0.09
131 0.1
132 0.11
133 0.14
134 0.14
135 0.13
136 0.13
137 0.12
138 0.11
139 0.11
140 0.09
141 0.1
142 0.1
143 0.1
144 0.09
145 0.09
146 0.08
147 0.08
148 0.09
149 0.06
150 0.08
151 0.09
152 0.11
153 0.15
154 0.17
155 0.22
156 0.23
157 0.3
158 0.31
159 0.34
160 0.33
161 0.3
162 0.33
163 0.28
164 0.3
165 0.24
166 0.2
167 0.17
168 0.16
169 0.17
170 0.12
171 0.11
172 0.09
173 0.09
174 0.12
175 0.13
176 0.15
177 0.17
178 0.22
179 0.23
180 0.24
181 0.25
182 0.25
183 0.26
184 0.28
185 0.3
186 0.3
187 0.3
188 0.3
189 0.29
190 0.27
191 0.28
192 0.24
193 0.19
194 0.17
195 0.16
196 0.15
197 0.14
198 0.14
199 0.11
200 0.1
201 0.09
202 0.06
203 0.05
204 0.04
205 0.04
206 0.03
207 0.02
208 0.02
209 0.02
210 0.01
211 0.01
212 0.01
213 0.01
214 0.01
215 0.01
216 0.01
217 0.01
218 0.01
219 0.01
220 0.02
221 0.02
222 0.02
223 0.04
224 0.06
225 0.11
226 0.2
227 0.28
228 0.37
229 0.48
230 0.58
231 0.66
232 0.75
233 0.81
234 0.81
235 0.8
236 0.8
237 0.79
238 0.75
239 0.73
240 0.69
241 0.59
242 0.54
243 0.48
244 0.4
245 0.32
246 0.34
247 0.3
248 0.31
249 0.35