Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VZ70

Protein Details
Accession A0A098VZ70    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
122-144VMWANADHKKRHRKAYHHHESGHBasic
NLS Segment(s)
Subcellular Location(s) extr 10, E.R. 7, mito 2, cyto 2, plas 2, pero 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004205  Cyt_bc1_su8  
IPR036642  Cyt_bc1_su8_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF02939  UcrQ  
Amino Acid Sequences MEILVVNICCPTTRLLIGDTCNASYLFKCSGVSFECSNLNLFCAPIKVQGGTGRVLILSMGQDNANNWWRFRYRNVFQYGISPFYQKAVLNDFAYESKKLLIHSTKNVLAFVPFGLGAIGLVMWANADHKKRHRKAYHHHESGHITAAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.22
5 0.26
6 0.25
7 0.22
8 0.22
9 0.21
10 0.19
11 0.17
12 0.18
13 0.15
14 0.14
15 0.15
16 0.14
17 0.17
18 0.18
19 0.21
20 0.19
21 0.19
22 0.19
23 0.19
24 0.21
25 0.17
26 0.16
27 0.13
28 0.12
29 0.11
30 0.1
31 0.1
32 0.11
33 0.12
34 0.11
35 0.12
36 0.16
37 0.17
38 0.16
39 0.16
40 0.13
41 0.12
42 0.11
43 0.09
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.09
52 0.16
53 0.16
54 0.16
55 0.18
56 0.2
57 0.21
58 0.26
59 0.31
60 0.29
61 0.35
62 0.39
63 0.38
64 0.36
65 0.39
66 0.36
67 0.3
68 0.27
69 0.2
70 0.16
71 0.15
72 0.17
73 0.13
74 0.13
75 0.14
76 0.16
77 0.16
78 0.16
79 0.16
80 0.16
81 0.18
82 0.17
83 0.13
84 0.12
85 0.13
86 0.13
87 0.17
88 0.21
89 0.23
90 0.27
91 0.32
92 0.33
93 0.33
94 0.32
95 0.27
96 0.22
97 0.19
98 0.14
99 0.1
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.03
108 0.03
109 0.02
110 0.03
111 0.03
112 0.06
113 0.11
114 0.15
115 0.22
116 0.32
117 0.43
118 0.5
119 0.61
120 0.68
121 0.73
122 0.81
123 0.85
124 0.87
125 0.84
126 0.79
127 0.74
128 0.7
129 0.62
130 0.57