Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VVW2

Protein Details
Accession A0A098VVW2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-24GDETQRRRKSTRQAIDRKSDKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001519  Ferritin  
IPR012347  Ferritin-like  
IPR009040  Ferritin-like_diiron  
IPR009078  Ferritin-like_SF  
IPR014034  Ferritin_CS  
IPR008331  Ferritin_DPS_dom  
Gene Ontology GO:0008199  F:ferric iron binding  
GO:0004322  F:ferroxidase activity  
GO:0006879  P:intracellular iron ion homeostasis  
GO:0006826  P:iron ion transport  
Pfam View protein in Pfam  
PF00210  Ferritin  
PROSITE View protein in PROSITE  
PS00204  FERRITIN_2  
PS50905  FERRITIN_LIKE  
CDD cd01056  Euk_Ferritin  
Amino Acid Sequences MAGDETQRRRKSTRQAIDRKSDKNAYLICHSLPMYSSKQNFSEACETALNKQVNMELGASYSYMSMSVFCSKDGVALPGLAAYCAKMSLEERDHALMLQDYIIKRGGQVTYDTIAPHPKASAWKSALEIVEAMLELEKSVNVSLLDLNKLASLKEDAHLSDFIEGTFLSEQVDSIKELVDMLVQLQRAGVDGLGLYIWDQNLLSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.82
4 0.87
5 0.87
6 0.8
7 0.76
8 0.72
9 0.62
10 0.58
11 0.53
12 0.46
13 0.43
14 0.41
15 0.33
16 0.31
17 0.29
18 0.23
19 0.21
20 0.21
21 0.22
22 0.26
23 0.29
24 0.29
25 0.3
26 0.34
27 0.34
28 0.35
29 0.36
30 0.29
31 0.29
32 0.28
33 0.27
34 0.25
35 0.33
36 0.28
37 0.22
38 0.21
39 0.2
40 0.19
41 0.19
42 0.17
43 0.09
44 0.09
45 0.09
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.11
55 0.11
56 0.11
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.1
76 0.12
77 0.12
78 0.13
79 0.14
80 0.14
81 0.13
82 0.13
83 0.09
84 0.07
85 0.07
86 0.08
87 0.07
88 0.08
89 0.09
90 0.08
91 0.08
92 0.1
93 0.1
94 0.08
95 0.09
96 0.1
97 0.1
98 0.11
99 0.11
100 0.1
101 0.13
102 0.12
103 0.12
104 0.1
105 0.1
106 0.15
107 0.17
108 0.23
109 0.21
110 0.22
111 0.23
112 0.26
113 0.25
114 0.2
115 0.18
116 0.11
117 0.1
118 0.08
119 0.07
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.04
126 0.04
127 0.05
128 0.05
129 0.06
130 0.08
131 0.09
132 0.1
133 0.1
134 0.1
135 0.1
136 0.11
137 0.1
138 0.1
139 0.1
140 0.1
141 0.12
142 0.13
143 0.13
144 0.15
145 0.15
146 0.14
147 0.13
148 0.12
149 0.11
150 0.1
151 0.09
152 0.09
153 0.09
154 0.08
155 0.08
156 0.08
157 0.08
158 0.09
159 0.1
160 0.09
161 0.09
162 0.09
163 0.08
164 0.08
165 0.08
166 0.07
167 0.07
168 0.07
169 0.1
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.1
176 0.08
177 0.06
178 0.05
179 0.06
180 0.06
181 0.06
182 0.05
183 0.06
184 0.06
185 0.07
186 0.07