Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098VU60

Protein Details
Accession A0A098VU60    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-37SATGAKRAFYCKKRKHELGRQAANTKHydrophilic
NLS Segment(s)
PositionSequence
10-50KRSATGAKRAFYCKKRKHELGRQAANTKLGPKRIHELRVRG
200-204IKHKK
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR042563  Ribosomal_protein_S8e_euk  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRSATGAKRAFYCKKRKHELGRQAANTKLGPKRIHELRVRGGNHKFRAMRLDSGNFAWGSEAITRKTRILDVVYNASNNELVRTKTLVKGAIVQIDATPFRQWWETHYGVAIGKKKAEEIADPSVAQKEPSEAVKAKHAMRAQDAAVDVHVKEQFNTGRLYAILKSRPGQSGRADGYILEGRELDFYLKKIKHKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.62
4 0.64
5 0.69
6 0.69
7 0.67
8 0.69
9 0.68
10 0.72
11 0.78
12 0.83
13 0.86
14 0.87
15 0.89
16 0.88
17 0.88
18 0.84
19 0.78
20 0.7
21 0.63
22 0.54
23 0.5
24 0.44
25 0.41
26 0.37
27 0.36
28 0.42
29 0.45
30 0.52
31 0.51
32 0.52
33 0.53
34 0.59
35 0.58
36 0.56
37 0.59
38 0.59
39 0.55
40 0.57
41 0.51
42 0.44
43 0.48
44 0.44
45 0.41
46 0.36
47 0.36
48 0.3
49 0.3
50 0.3
51 0.23
52 0.2
53 0.15
54 0.11
55 0.1
56 0.11
57 0.12
58 0.12
59 0.16
60 0.17
61 0.17
62 0.18
63 0.18
64 0.17
65 0.18
66 0.18
67 0.18
68 0.21
69 0.21
70 0.2
71 0.19
72 0.17
73 0.15
74 0.13
75 0.12
76 0.09
77 0.09
78 0.1
79 0.12
80 0.13
81 0.14
82 0.16
83 0.15
84 0.14
85 0.17
86 0.17
87 0.16
88 0.15
89 0.13
90 0.11
91 0.11
92 0.11
93 0.09
94 0.08
95 0.06
96 0.07
97 0.09
98 0.09
99 0.12
100 0.18
101 0.19
102 0.18
103 0.19
104 0.19
105 0.18
106 0.22
107 0.23
108 0.17
109 0.17
110 0.17
111 0.17
112 0.18
113 0.18
114 0.15
115 0.16
116 0.19
117 0.19
118 0.19
119 0.2
120 0.2
121 0.19
122 0.18
123 0.13
124 0.1
125 0.11
126 0.12
127 0.16
128 0.16
129 0.17
130 0.23
131 0.27
132 0.27
133 0.31
134 0.32
135 0.29
136 0.3
137 0.32
138 0.26
139 0.24
140 0.23
141 0.18
142 0.17
143 0.16
144 0.12
145 0.13
146 0.16
147 0.14
148 0.13
149 0.18
150 0.19
151 0.2
152 0.22
153 0.19
154 0.17
155 0.17
156 0.19
157 0.17
158 0.21
159 0.23
160 0.24
161 0.27
162 0.29
163 0.35
164 0.35
165 0.37
166 0.35
167 0.4
168 0.39
169 0.38
170 0.35
171 0.29
172 0.31
173 0.31
174 0.27
175 0.19
176 0.17
177 0.15
178 0.16
179 0.17
180 0.15
181 0.13
182 0.15
183 0.23
184 0.28