Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JUK7

Protein Details
Accession C4JUK7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
57-85DIVLIKKMPPKRPSKRKFKQEPLKEIQQLHydrophilic
NLS Segment(s)
PositionSequence
62-75KKMPPKRPSKRKFK
Subcellular Location(s) cyto 17, cyto_nucl 11.833, mito_nucl 5.666, mito 5.5, nucl 4.5
Family & Domain DBs
KEGG ure:UREG_04810  -  
Amino Acid Sequences MITATEEENTTNPKLAHSMTLHMAALYTKKNDFAELKMLSVKVSQQQSKKKIKILDDIVLIKKMPPKRPSKRKFKQEPLKEIQQLTRNPPTAQKTTNGDQAPSEKEEDGDQNFELLPLSVQATVSMQAAVPVQAAVPVQAAVPVQAAVPAQAAASVQAAPPVQATVPAQAAPPVQATVPAQAAASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.25
4 0.23
5 0.25
6 0.24
7 0.26
8 0.24
9 0.21
10 0.21
11 0.16
12 0.17
13 0.17
14 0.17
15 0.16
16 0.19
17 0.2
18 0.24
19 0.24
20 0.24
21 0.28
22 0.26
23 0.27
24 0.26
25 0.25
26 0.22
27 0.21
28 0.2
29 0.19
30 0.25
31 0.29
32 0.35
33 0.44
34 0.53
35 0.62
36 0.65
37 0.64
38 0.63
39 0.62
40 0.63
41 0.58
42 0.53
43 0.46
44 0.46
45 0.41
46 0.37
47 0.32
48 0.25
49 0.26
50 0.28
51 0.32
52 0.36
53 0.45
54 0.55
55 0.67
56 0.75
57 0.8
58 0.84
59 0.87
60 0.9
61 0.9
62 0.9
63 0.88
64 0.87
65 0.83
66 0.8
67 0.72
68 0.63
69 0.56
70 0.52
71 0.45
72 0.42
73 0.41
74 0.35
75 0.32
76 0.36
77 0.36
78 0.33
79 0.32
80 0.3
81 0.28
82 0.29
83 0.35
84 0.3
85 0.26
86 0.24
87 0.25
88 0.24
89 0.21
90 0.2
91 0.13
92 0.13
93 0.14
94 0.16
95 0.14
96 0.14
97 0.12
98 0.11
99 0.11
100 0.1
101 0.09
102 0.07
103 0.06
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.07
111 0.07
112 0.07
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.06
128 0.05
129 0.06
130 0.06
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.06
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.08
145 0.09
146 0.09
147 0.09
148 0.09
149 0.08
150 0.1
151 0.12
152 0.12
153 0.13
154 0.14
155 0.14
156 0.15
157 0.16
158 0.14
159 0.15
160 0.13
161 0.11
162 0.13
163 0.14
164 0.15
165 0.15
166 0.15