Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VSR7

Protein Details
Accession A0A098VSR7   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-36KAMSSTLSKRDKKKLRLKSKFFLSVLHydrophilic
NLS Segment(s)
PositionSequence
20-27RDKKKLRL
Subcellular Location(s) mito 18.5, mito_nucl 12.166, cyto_nucl 5.333, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MFVSSMLQYDKAMSSTLSKRDKKKLRLKSKFFLSVLKSDSTAKLQKVFTSAHLNQLKKDRKEKTLVPWQEFFSKVLKSFWSPTYPAGNQIPNWDRILNLNDKKSIDQLKWIFFSERIAKRDIFRFFQASEAGKFFPPSFKMPSIASITKNLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.3
4 0.38
5 0.44
6 0.51
7 0.61
8 0.7
9 0.75
10 0.8
11 0.82
12 0.84
13 0.88
14 0.88
15 0.87
16 0.85
17 0.83
18 0.74
19 0.69
20 0.61
21 0.55
22 0.5
23 0.42
24 0.35
25 0.28
26 0.28
27 0.27
28 0.28
29 0.25
30 0.27
31 0.26
32 0.26
33 0.27
34 0.27
35 0.24
36 0.29
37 0.28
38 0.32
39 0.38
40 0.37
41 0.37
42 0.46
43 0.51
44 0.47
45 0.55
46 0.51
47 0.49
48 0.54
49 0.55
50 0.54
51 0.56
52 0.56
53 0.51
54 0.49
55 0.45
56 0.43
57 0.4
58 0.32
59 0.24
60 0.2
61 0.17
62 0.16
63 0.15
64 0.14
65 0.16
66 0.17
67 0.18
68 0.17
69 0.19
70 0.23
71 0.23
72 0.24
73 0.24
74 0.24
75 0.21
76 0.27
77 0.27
78 0.23
79 0.24
80 0.21
81 0.19
82 0.2
83 0.23
84 0.25
85 0.27
86 0.28
87 0.29
88 0.3
89 0.31
90 0.33
91 0.34
92 0.26
93 0.3
94 0.31
95 0.32
96 0.33
97 0.34
98 0.3
99 0.26
100 0.3
101 0.31
102 0.35
103 0.33
104 0.35
105 0.35
106 0.37
107 0.44
108 0.43
109 0.38
110 0.35
111 0.37
112 0.34
113 0.35
114 0.35
115 0.3
116 0.28
117 0.26
118 0.24
119 0.22
120 0.23
121 0.21
122 0.23
123 0.24
124 0.26
125 0.29
126 0.3
127 0.32
128 0.31
129 0.35
130 0.37
131 0.38
132 0.36