Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VVN2

Protein Details
Accession A0A098VVN2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-118LITITKQGRKLRKEKKNRAKKIRGSKKHKPQSGKKBasic
NLS Segment(s)
PositionSequence
90-118QGRKLRKEKKNRAKKIRGSKKHKPQSGKK
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MTNPLLKRKQMVIDVIHPGLANISQADLRAKLAKMYKADPQAVVVFGNKTAFGGGKSTCFALIYDNVDAVKSFEPKFHQVRNGLITITKQGRKLRKEKKNRAKKIRGSKKHKPQSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.37
4 0.3
5 0.26
6 0.21
7 0.16
8 0.12
9 0.06
10 0.07
11 0.07
12 0.08
13 0.1
14 0.09
15 0.11
16 0.14
17 0.14
18 0.17
19 0.21
20 0.24
21 0.26
22 0.28
23 0.32
24 0.34
25 0.35
26 0.31
27 0.29
28 0.25
29 0.23
30 0.21
31 0.16
32 0.11
33 0.1
34 0.1
35 0.08
36 0.07
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.12
61 0.16
62 0.22
63 0.27
64 0.29
65 0.33
66 0.32
67 0.36
68 0.37
69 0.34
70 0.29
71 0.25
72 0.22
73 0.23
74 0.27
75 0.26
76 0.28
77 0.35
78 0.43
79 0.51
80 0.61
81 0.65
82 0.7
83 0.78
84 0.84
85 0.88
86 0.91
87 0.94
88 0.94
89 0.94
90 0.94
91 0.94
92 0.94
93 0.94
94 0.92
95 0.92
96 0.92
97 0.92
98 0.9