Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VVF1

Protein Details
Accession A0A098VVF1   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAAKIPIIKKRTKKFIRHQSDRFTSVKPSWRRPKGIDNRVRRRFSGHydrophilic
NLS Segment(s)
PositionSequence
9-20KKRTKKFIRHQS
25-42SVKPSWRRPKGIDNRVRR
Subcellular Location(s) nucl 17, mito_nucl 13, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAKIPIIKKRTKKFIRHQSDRFTSVKPSWRRPKGIDNRVRRRFSGQIQMPKIGFGSNKLTKFLMPNGLRRFVIRNVKELELLMMHNSTYAAEVAHNVCAQKRLAIVNRARELNVKLTNGYARLQISEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.89
4 0.9
5 0.88
6 0.87
7 0.83
8 0.78
9 0.69
10 0.6
11 0.55
12 0.5
13 0.52
14 0.49
15 0.53
16 0.59
17 0.64
18 0.67
19 0.66
20 0.72
21 0.73
22 0.77
23 0.76
24 0.76
25 0.8
26 0.83
27 0.81
28 0.72
29 0.67
30 0.62
31 0.57
32 0.56
33 0.52
34 0.52
35 0.51
36 0.53
37 0.47
38 0.41
39 0.36
40 0.27
41 0.2
42 0.14
43 0.19
44 0.21
45 0.22
46 0.23
47 0.23
48 0.23
49 0.24
50 0.23
51 0.24
52 0.21
53 0.27
54 0.29
55 0.31
56 0.3
57 0.3
58 0.31
59 0.29
60 0.36
61 0.3
62 0.33
63 0.33
64 0.34
65 0.33
66 0.3
67 0.24
68 0.16
69 0.15
70 0.11
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.07
81 0.08
82 0.1
83 0.1
84 0.1
85 0.11
86 0.13
87 0.14
88 0.13
89 0.14
90 0.19
91 0.23
92 0.32
93 0.36
94 0.43
95 0.47
96 0.47
97 0.46
98 0.44
99 0.41
100 0.41
101 0.4
102 0.33
103 0.29
104 0.31
105 0.33
106 0.31
107 0.29
108 0.25
109 0.21
110 0.21