Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VSU4

Protein Details
Accession A0A098VSU4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
129-153EALPTAEQQRPIRKRKRKPSTKEDVHydrophilic
NLS Segment(s)
PositionSequence
118-122KKRKA
137-148QRPIRKRKRKPS
Subcellular Location(s) mito 20.5, mito_nucl 13.166, nucl 4.5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
Gene Ontology GO:0032040  C:small-subunit processome  
Pfam View protein in Pfam  
PF04900  Fcf1  
Amino Acid Sequences MLPALCPRSIAFGSKSVACGNVFIVLGSANKHKYVVCSQDTAFLQELSTLGGVPTIHIYKGVLQLDPISSASKALKEEKEAQKDKLTKAERREIATLINQPDPTDVPQKRGPNPLSVKKRKALVGRNSEALPTAEQQRPIRKRKRKPSTKEDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.23
4 0.24
5 0.21
6 0.19
7 0.15
8 0.14
9 0.13
10 0.11
11 0.11
12 0.09
13 0.09
14 0.11
15 0.15
16 0.14
17 0.14
18 0.15
19 0.16
20 0.19
21 0.24
22 0.29
23 0.28
24 0.29
25 0.29
26 0.35
27 0.35
28 0.33
29 0.28
30 0.21
31 0.18
32 0.15
33 0.15
34 0.09
35 0.09
36 0.06
37 0.05
38 0.06
39 0.05
40 0.05
41 0.08
42 0.07
43 0.07
44 0.08
45 0.08
46 0.09
47 0.14
48 0.15
49 0.12
50 0.12
51 0.13
52 0.13
53 0.13
54 0.12
55 0.08
56 0.07
57 0.08
58 0.08
59 0.09
60 0.11
61 0.14
62 0.14
63 0.16
64 0.25
65 0.31
66 0.39
67 0.4
68 0.4
69 0.43
70 0.46
71 0.44
72 0.44
73 0.43
74 0.4
75 0.43
76 0.5
77 0.46
78 0.46
79 0.46
80 0.38
81 0.35
82 0.33
83 0.32
84 0.26
85 0.25
86 0.22
87 0.2
88 0.21
89 0.2
90 0.19
91 0.24
92 0.22
93 0.25
94 0.31
95 0.37
96 0.4
97 0.47
98 0.46
99 0.46
100 0.54
101 0.58
102 0.63
103 0.67
104 0.68
105 0.64
106 0.67
107 0.64
108 0.64
109 0.64
110 0.63
111 0.64
112 0.62
113 0.61
114 0.56
115 0.5
116 0.43
117 0.35
118 0.27
119 0.2
120 0.23
121 0.23
122 0.29
123 0.34
124 0.43
125 0.51
126 0.6
127 0.68
128 0.72
129 0.8
130 0.85
131 0.91
132 0.91
133 0.92