Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JUC9

Protein Details
Accession C4JUC9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
10-30ATRIKAEKSNIKRKIKKVTVEHydrophilic
NLS Segment(s)
PositionSequence
18-25SNIKRKIK
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR041588  Integrase_H2C2  
KEGG ure:UREG_06068  -  
Pfam View protein in Pfam  
PF17921  Integrase_H2C2  
Amino Acid Sequences MILNQQVLRATRIKAEKSNIKRKIKKVTVEDEYASKIDDENKNFKKEDGMILYHGLIYVSRKIRKEVMIQEHDTVTSEHFGIDKTIKKITRMYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.51
4 0.58
5 0.67
6 0.7
7 0.75
8 0.78
9 0.8
10 0.83
11 0.81
12 0.79
13 0.75
14 0.74
15 0.68
16 0.63
17 0.56
18 0.47
19 0.41
20 0.33
21 0.26
22 0.17
23 0.13
24 0.16
25 0.19
26 0.22
27 0.29
28 0.33
29 0.36
30 0.36
31 0.35
32 0.31
33 0.28
34 0.28
35 0.21
36 0.19
37 0.17
38 0.17
39 0.17
40 0.14
41 0.13
42 0.09
43 0.07
44 0.07
45 0.11
46 0.17
47 0.21
48 0.22
49 0.25
50 0.29
51 0.32
52 0.37
53 0.41
54 0.44
55 0.46
56 0.48
57 0.47
58 0.44
59 0.4
60 0.35
61 0.26
62 0.18
63 0.13
64 0.11
65 0.1
66 0.09
67 0.1
68 0.12
69 0.16
70 0.21
71 0.23
72 0.3
73 0.32
74 0.35