Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098VVH6

Protein Details
Accession A0A098VVH6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-80RNGIRYVYCKVNRRHKRRQGBasic
NLS Segment(s)
PositionSequence
76-77KR
Subcellular Location(s) mito 9.5, nucl 8.5, cyto_mito 7.833, cyto_nucl 7.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MANLSIPSKASGMRSSFFSIPEMLGTFGGSPLFSSSFQQIRGLKVGVSITRRCENCYIVVRNGIRYVYCKVNRRHKRRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.28
4 0.27
5 0.25
6 0.21
7 0.18
8 0.18
9 0.15
10 0.11
11 0.1
12 0.09
13 0.08
14 0.07
15 0.07
16 0.06
17 0.05
18 0.06
19 0.07
20 0.07
21 0.08
22 0.11
23 0.13
24 0.13
25 0.18
26 0.18
27 0.18
28 0.19
29 0.18
30 0.14
31 0.14
32 0.15
33 0.13
34 0.16
35 0.17
36 0.2
37 0.25
38 0.26
39 0.27
40 0.29
41 0.28
42 0.29
43 0.35
44 0.35
45 0.31
46 0.38
47 0.36
48 0.35
49 0.36
50 0.31
51 0.24
52 0.23
53 0.26
54 0.29
55 0.35
56 0.41
57 0.49
58 0.59
59 0.69
60 0.76