Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098VS62

Protein Details
Accession A0A098VS62    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-129KPLDIRPKKTRAIRRRMTKSEINKKTERQRKKAAHFPKANFVHydrophilic
NLS Segment(s)
PositionSequence
85-122KKYKPLDIRPKKTRAIRRRMTKSEINKKTERQRKKAAH
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVSFTFSVISSIVKAHELRNISKAELMKQLSDLKQELSALRVNQASSATAPKLARISVVRKSIARVLTVIQQQQRSEMKAFYAGKKYKPLDIRPKKTRAIRRRMTKSEINKKTERQRKKAAHFPKANFVVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.19
4 0.22
5 0.23
6 0.28
7 0.28
8 0.26
9 0.29
10 0.29
11 0.27
12 0.3
13 0.3
14 0.25
15 0.26
16 0.31
17 0.28
18 0.3
19 0.28
20 0.22
21 0.21
22 0.22
23 0.19
24 0.16
25 0.18
26 0.15
27 0.16
28 0.16
29 0.15
30 0.15
31 0.15
32 0.13
33 0.11
34 0.13
35 0.11
36 0.14
37 0.14
38 0.14
39 0.15
40 0.14
41 0.15
42 0.15
43 0.19
44 0.21
45 0.24
46 0.24
47 0.24
48 0.26
49 0.28
50 0.26
51 0.22
52 0.17
53 0.15
54 0.18
55 0.2
56 0.22
57 0.2
58 0.21
59 0.21
60 0.25
61 0.25
62 0.23
63 0.22
64 0.19
65 0.17
66 0.21
67 0.23
68 0.22
69 0.3
70 0.3
71 0.32
72 0.39
73 0.4
74 0.4
75 0.45
76 0.5
77 0.52
78 0.61
79 0.68
80 0.69
81 0.74
82 0.75
83 0.77
84 0.79
85 0.78
86 0.78
87 0.78
88 0.8
89 0.84
90 0.83
91 0.81
92 0.79
93 0.79
94 0.8
95 0.79
96 0.75
97 0.72
98 0.73
99 0.77
100 0.79
101 0.78
102 0.76
103 0.78
104 0.81
105 0.84
106 0.86
107 0.85
108 0.86
109 0.85
110 0.8
111 0.8
112 0.74