Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098VNA2

Protein Details
Accession A0A098VNA2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-100GTEFQPSTRKRKRKHGFLKRKSTRSGMRILRRRMNKGRRYLSHBasic
NLS Segment(s)
PositionSequence
66-96RKRKRKHGFLKRKSTRSGMRILRRRMNKGRR
Subcellular Location(s) mito 18, mito_nucl 12.666, cyto_mito 10.666, nucl 6, cyto_nucl 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFGRFARFGCGPLVSQLSSIKFKGNIFSASTVLARGPPACSNQHTFGSSIIARWTCYGTEFQPSTRKRKRKHGFLKRKSTRSGMRILRRRMNKGRRYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.21
5 0.23
6 0.23
7 0.22
8 0.22
9 0.22
10 0.24
11 0.24
12 0.23
13 0.22
14 0.23
15 0.2
16 0.19
17 0.18
18 0.15
19 0.13
20 0.11
21 0.1
22 0.08
23 0.1
24 0.1
25 0.13
26 0.15
27 0.18
28 0.21
29 0.23
30 0.25
31 0.24
32 0.23
33 0.2
34 0.2
35 0.17
36 0.14
37 0.13
38 0.11
39 0.1
40 0.1
41 0.11
42 0.08
43 0.09
44 0.11
45 0.1
46 0.15
47 0.16
48 0.18
49 0.26
50 0.29
51 0.39
52 0.47
53 0.55
54 0.55
55 0.66
56 0.73
57 0.76
58 0.84
59 0.85
60 0.87
61 0.88
62 0.94
63 0.92
64 0.89
65 0.83
66 0.8
67 0.76
68 0.69
69 0.69
70 0.67
71 0.67
72 0.7
73 0.73
74 0.74
75 0.74
76 0.79
77 0.81
78 0.82
79 0.8
80 0.82