Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098VR11

Protein Details
Accession A0A098VR11   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-40SLVQMEMKKHHKRNKNDGSNNQIHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.833, nucl 8.5, cyto_nucl 5.666
Family & Domain DBs
Amino Acid Sequences MTNGFYRKDSNTHVRKSLVQMEMKKHHKRNKNDGSNNQIHGLSKSMNVNTMGYTCGPGVSDWIIWEAHMRTEEDIMIEISNSKKFKFVKFMVIIGEGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.54
4 0.54
5 0.5
6 0.48
7 0.47
8 0.51
9 0.57
10 0.63
11 0.66
12 0.67
13 0.7
14 0.72
15 0.76
16 0.8
17 0.82
18 0.83
19 0.83
20 0.81
21 0.81
22 0.77
23 0.69
24 0.6
25 0.49
26 0.39
27 0.3
28 0.25
29 0.17
30 0.13
31 0.14
32 0.12
33 0.13
34 0.13
35 0.13
36 0.11
37 0.11
38 0.1
39 0.08
40 0.09
41 0.07
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.06
49 0.08
50 0.07
51 0.07
52 0.09
53 0.09
54 0.09
55 0.1
56 0.11
57 0.11
58 0.12
59 0.12
60 0.1
61 0.1
62 0.09
63 0.08
64 0.08
65 0.09
66 0.1
67 0.16
68 0.16
69 0.16
70 0.22
71 0.25
72 0.3
73 0.38
74 0.39
75 0.43
76 0.45
77 0.47
78 0.43