FuNGI

A0A098VRV0

Protein Details

Accession

A0A098VRV0

Localization Confidence

Medium

Confidence Score

12.1

NoLS Segment(s)

Position	Sequence	Protein Nature
417-445	WYSRAALQGHRKAKRRRAELKKSIRFSSS	Hydrophilic

NLS Segment(s)

Position	Sequence
30-30	K
426-438	HRKAKRRRAELKK

Subcellular Location(s)

mito 12, nucl 7, cyto 7, cyto_nucl 7

Family & Domain DBs

InterPro	View protein in InterPro IPR006597 Sel1-like IPR011990 TPR-like_helical_dom_sf
Pfam	View protein in Pfam PF08238 Sel1

Amino Acid Sequences

MVPQTPGTTVPLSFDEALKAIREKMATARKKKGGIDPHAQLAIVKGIIHLAAMAAECTGALVAMPIDDDEDHDQNSDVQEPCGAQVDTQPNVRNSAINFGNSEGEGRPVSTPPGSDLLRIDLTASAEVLRAEGMHMLKRLASSGNGRHPLPEAQCFLAQLLRGHGDQRLCIKTNMDRAFSLSLQASKHGLSEAIFWTALSYERGMGVRKDAARAVTFYRKAATLGHGRAMHRLAIILQHGQLGMAQAPKEAFTWLKRAASIGSIPGAIHDLALMFEHGNGNSIAIPDDSYALELFKKASAMRYAPSMVKLGTCFEYGRLGCPLDPRKSIEWYRKAAELGDPAAELALSGWYLTGAKEASGSDVEGDGVILPQSDKDAYAWAKRAAERRDPRAEYALGRYCELGVGLDAPALQEALHWYSRAALQGHRKAKRRRAELKKSIRFSSSETFSTSSSSIRFVKSLLSGGRWGS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.19
3	0.19
4	0.2
5	0.19
6	0.19
7	0.17
8	0.19
9	0.19
10	0.19
11	0.27
12	0.37
13	0.44
14	0.51
15	0.59
16	0.62
17	0.67
18	0.71
19	0.7
20	0.7
21	0.68
22	0.68
23	0.63
24	0.61
25	0.56
26	0.5
27	0.41
28	0.33
29	0.27
30	0.19
31	0.15
32	0.1
33	0.1
34	0.1
35	0.09
36	0.07
37	0.05
38	0.05
39	0.05
40	0.05
41	0.05
42	0.05
43	0.04
44	0.04
45	0.04
46	0.03
47	0.03
48	0.03
49	0.03
50	0.03
51	0.04
52	0.04
53	0.05
54	0.05
55	0.08
56	0.12
57	0.14
58	0.14
59	0.15
60	0.15
61	0.15
62	0.17
63	0.19
64	0.16
65	0.14
66	0.15
67	0.15
68	0.15
69	0.18
70	0.17
71	0.12
72	0.18
73	0.23
74	0.24
75	0.29
76	0.32
77	0.29
78	0.33
79	0.33
80	0.29
81	0.24
82	0.29
83	0.27
84	0.24
85	0.23
86	0.21
87	0.22
88	0.19
89	0.2
90	0.13
91	0.13
92	0.12
93	0.13
94	0.13
95	0.12
96	0.15
97	0.14
98	0.14
99	0.14
100	0.19
101	0.18
102	0.18
103	0.18
104	0.2
105	0.19
106	0.19
107	0.17
108	0.13
109	0.13
110	0.12
111	0.12
112	0.08
113	0.08
114	0.08
115	0.07
116	0.06
117	0.05
118	0.05
119	0.08
120	0.09
121	0.11
122	0.12
123	0.12
124	0.13
125	0.13
126	0.14
127	0.11
128	0.13
129	0.16
130	0.21
131	0.29
132	0.31
133	0.31
134	0.31
135	0.32
136	0.35
137	0.32
138	0.3
139	0.25
140	0.23
141	0.24
142	0.23
143	0.21
144	0.18
145	0.16
146	0.13
147	0.12
148	0.12
149	0.12
150	0.13
151	0.15
152	0.14
153	0.15
154	0.2
155	0.22
156	0.22
157	0.23
158	0.25
159	0.26
160	0.35
161	0.36
162	0.32
163	0.28
164	0.28
165	0.3
166	0.27
167	0.25
168	0.17
169	0.16
170	0.14
171	0.16
172	0.14
173	0.12
174	0.12
175	0.1
176	0.1
177	0.08
178	0.1
179	0.09
180	0.1
181	0.09
182	0.09
183	0.09
184	0.09
185	0.09
186	0.07
187	0.07
188	0.06
189	0.07
190	0.08
191	0.09
192	0.09
193	0.1
194	0.13
195	0.14
196	0.15
197	0.15
198	0.15
199	0.15
200	0.16
201	0.18
202	0.21
203	0.21
204	0.2
205	0.2
206	0.19
207	0.19
208	0.18
209	0.19
210	0.17
211	0.18
212	0.21
213	0.23
214	0.23
215	0.25
216	0.25
217	0.21
218	0.15
219	0.14
220	0.1
221	0.09
222	0.1
223	0.08
224	0.08
225	0.07
226	0.07
227	0.07
228	0.07
229	0.06
230	0.06
231	0.07
232	0.06
233	0.06
234	0.07
235	0.07
236	0.08
237	0.08
238	0.08
239	0.09
240	0.14
241	0.15
242	0.16
243	0.16
244	0.16
245	0.15
246	0.15
247	0.14
248	0.1
249	0.09
250	0.08
251	0.08
252	0.07
253	0.08
254	0.07
255	0.06
256	0.05
257	0.04
258	0.04
259	0.05
260	0.05
261	0.04
262	0.04
263	0.05
264	0.05
265	0.06
266	0.06
267	0.06
268	0.06
269	0.07
270	0.07
271	0.06
272	0.07
273	0.06
274	0.07
275	0.06
276	0.07
277	0.06
278	0.06
279	0.07
280	0.07
281	0.07
282	0.06
283	0.08
284	0.08
285	0.1
286	0.13
287	0.14
288	0.15
289	0.17
290	0.19
291	0.18
292	0.19
293	0.18
294	0.15
295	0.14
296	0.14
297	0.14
298	0.13
299	0.14
300	0.12
301	0.12
302	0.17
303	0.16
304	0.18
305	0.18
306	0.17
307	0.16
308	0.24
309	0.3
310	0.29
311	0.31
312	0.33
313	0.34
314	0.4
315	0.46
316	0.48
317	0.49
318	0.49
319	0.49
320	0.47
321	0.45
322	0.39
323	0.35
324	0.28
325	0.22
326	0.18
327	0.15
328	0.13
329	0.12
330	0.1
331	0.07
332	0.05
333	0.04
334	0.03
335	0.03
336	0.03
337	0.04
338	0.04
339	0.05
340	0.06
341	0.06
342	0.06
343	0.07
344	0.07
345	0.09
346	0.09
347	0.09
348	0.08
349	0.08
350	0.08
351	0.07
352	0.07
353	0.05
354	0.05
355	0.05
356	0.05
357	0.04
358	0.05
359	0.06
360	0.07
361	0.07
362	0.07
363	0.13
364	0.16
365	0.2
366	0.24
367	0.26
368	0.3
369	0.34
370	0.41
371	0.42
372	0.5
373	0.53
374	0.58
375	0.64
376	0.63
377	0.62
378	0.6
379	0.56
380	0.48
381	0.48
382	0.47
383	0.39
384	0.36
385	0.33
386	0.28
387	0.26
388	0.23
389	0.15
390	0.08
391	0.08
392	0.07
393	0.07
394	0.07
395	0.07
396	0.07
397	0.06
398	0.05
399	0.05
400	0.08
401	0.12
402	0.13
403	0.13
404	0.13
405	0.15
406	0.17
407	0.21
408	0.2
409	0.23
410	0.32
411	0.41
412	0.51
413	0.57
414	0.65
415	0.71
416	0.78
417	0.82
418	0.82
419	0.84
420	0.85
421	0.89
422	0.9
423	0.91
424	0.92
425	0.88
426	0.82
427	0.74
428	0.65
429	0.6
430	0.58
431	0.51
432	0.43
433	0.41
434	0.38
435	0.35
436	0.36
437	0.3
438	0.25
439	0.21
440	0.24
441	0.24
442	0.24
443	0.25
444	0.22
445	0.25
446	0.25
447	0.3
448	0.28
449	0.27

A0A098VRV0

3D AlphaFold-predicted Structure Viewer