Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098VNL9

Protein Details
Accession A0A098VNL9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-56DNDLKQKRGRRKAAHTKLTNHydrophilic
NLS Segment(s)
PositionSequence
42-51QKRGRRKAAH
Subcellular Location(s) nucl 17, cyto 7, pero 2
Family & Domain DBs
Amino Acid Sequences MSEAVAKAESIESGGNISIEDEMKPEAMKNEGPLLPDNDLKQKRGRRKAAHTKLTNQLRKAVADHKMGAIRLKKLQVAAWRDELIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.11
16 0.11
17 0.15
18 0.16
19 0.17
20 0.18
21 0.19
22 0.18
23 0.19
24 0.19
25 0.24
26 0.24
27 0.25
28 0.3
29 0.35
30 0.43
31 0.51
32 0.59
33 0.57
34 0.67
35 0.76
36 0.79
37 0.82
38 0.76
39 0.72
40 0.72
41 0.75
42 0.7
43 0.6
44 0.56
45 0.47
46 0.45
47 0.42
48 0.38
49 0.34
50 0.32
51 0.32
52 0.29
53 0.3
54 0.3
55 0.33
56 0.31
57 0.29
58 0.31
59 0.33
60 0.32
61 0.31
62 0.35
63 0.37
64 0.38
65 0.39
66 0.39