Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JI09

Protein Details
Accession C4JI09    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-118EKMAEKMHRKRVERLKRREKRNKLLKSBasic
NLS Segment(s)
PositionSequence
49-118ERKAMAAIKEKEKEMKEEKEAERQRRIQAIKDRRAAKEEKERYEKMAEKMHRKRVERLKRREKRNKLLKS
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG ure:UREG_01434  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSTDAPRSSGPATAPPKGMRENGKNWHDTKAAFRPTKGLTSYARRLDERKAMAAIKEKEKEMKEEKEAERQRRIQAIKDRRAAKEEKERYEKMAEKMHRKRVERLKRREKRNKLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.34
4 0.37
5 0.38
6 0.42
7 0.41
8 0.43
9 0.47
10 0.52
11 0.55
12 0.56
13 0.54
14 0.53
15 0.47
16 0.41
17 0.4
18 0.4
19 0.44
20 0.4
21 0.39
22 0.39
23 0.39
24 0.42
25 0.36
26 0.31
27 0.27
28 0.32
29 0.38
30 0.39
31 0.4
32 0.37
33 0.38
34 0.38
35 0.4
36 0.35
37 0.3
38 0.26
39 0.24
40 0.24
41 0.3
42 0.29
43 0.28
44 0.28
45 0.27
46 0.29
47 0.29
48 0.33
49 0.31
50 0.31
51 0.3
52 0.35
53 0.37
54 0.42
55 0.48
56 0.49
57 0.51
58 0.51
59 0.5
60 0.51
61 0.5
62 0.48
63 0.51
64 0.56
65 0.56
66 0.6
67 0.62
68 0.56
69 0.6
70 0.55
71 0.52
72 0.53
73 0.53
74 0.54
75 0.57
76 0.56
77 0.55
78 0.6
79 0.58
80 0.51
81 0.53
82 0.52
83 0.55
84 0.63
85 0.69
86 0.7
87 0.69
88 0.74
89 0.76
90 0.8
91 0.8
92 0.82
93 0.83
94 0.85
95 0.92
96 0.93
97 0.93
98 0.93