Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060SEW2

Protein Details
Accession A0A060SEW2    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-63EEQYARAKVRRRRRPAPRHTTQLTHydrophilic
NLS Segment(s)
PositionSequence
44-57ARAKVRRRRRPAPR
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
Amino Acid Sequences MSGKTAEVRPSHNARHPVAHRRSPPSVQDPAWKNKEKAEEEQYARAKVRRRRRPAPRHTTQLTHPCTPRDASQEVEALKAIRDELAAKQPAKSELDKDIEGGYGGQEDLEDRYATTLGMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.59
4 0.62
5 0.64
6 0.65
7 0.65
8 0.65
9 0.68
10 0.63
11 0.63
12 0.59
13 0.56
14 0.49
15 0.51
16 0.5
17 0.53
18 0.57
19 0.55
20 0.5
21 0.49
22 0.56
23 0.51
24 0.51
25 0.49
26 0.48
27 0.46
28 0.53
29 0.5
30 0.44
31 0.42
32 0.39
33 0.4
34 0.41
35 0.49
36 0.52
37 0.58
38 0.66
39 0.75
40 0.83
41 0.86
42 0.88
43 0.83
44 0.81
45 0.74
46 0.67
47 0.61
48 0.59
49 0.53
50 0.47
51 0.42
52 0.35
53 0.35
54 0.33
55 0.3
56 0.26
57 0.23
58 0.21
59 0.21
60 0.23
61 0.21
62 0.2
63 0.18
64 0.13
65 0.12
66 0.1
67 0.09
68 0.06
69 0.06
70 0.07
71 0.09
72 0.16
73 0.2
74 0.21
75 0.22
76 0.24
77 0.26
78 0.29
79 0.28
80 0.24
81 0.25
82 0.29
83 0.28
84 0.27
85 0.25
86 0.21
87 0.2
88 0.17
89 0.11
90 0.08
91 0.07
92 0.06
93 0.05
94 0.06
95 0.08
96 0.1
97 0.09
98 0.09
99 0.11
100 0.11