Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JN40

Protein Details
Accession C4JN40    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
100-125KMESGNGKKKERKRRREERGLYSRVCBasic
NLS Segment(s)
PositionSequence
106-117GKKKERKRRREE
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 7, cyto 6
Family & Domain DBs
KEGG ure:UREG_04248  -  
Amino Acid Sequences MAFEFLSRELGTGFVQISQKNLRRYSAGSIGLNEPPMKVFGDVLKVIRELDFTGDLPYILELTGIVAAREQDGGGSEIIYPRSESAGSLEEQGNGPQEEKMESGNGKKKERKRRREERGLYSRVCPSLHIVTDAGIALRVRVNMELNGGSFHFFGDESSSAAGLTVITKPDVFGALGYEGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.2
5 0.28
6 0.33
7 0.39
8 0.41
9 0.4
10 0.4
11 0.42
12 0.44
13 0.42
14 0.41
15 0.35
16 0.35
17 0.35
18 0.33
19 0.33
20 0.27
21 0.2
22 0.15
23 0.15
24 0.14
25 0.11
26 0.11
27 0.1
28 0.15
29 0.16
30 0.16
31 0.16
32 0.16
33 0.16
34 0.15
35 0.14
36 0.1
37 0.11
38 0.12
39 0.11
40 0.12
41 0.11
42 0.11
43 0.1
44 0.1
45 0.07
46 0.06
47 0.05
48 0.03
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.05
58 0.04
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.08
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.08
73 0.09
74 0.09
75 0.11
76 0.11
77 0.1
78 0.1
79 0.11
80 0.1
81 0.09
82 0.09
83 0.07
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.09
90 0.14
91 0.21
92 0.26
93 0.32
94 0.39
95 0.48
96 0.58
97 0.68
98 0.73
99 0.77
100 0.83
101 0.87
102 0.91
103 0.9
104 0.89
105 0.88
106 0.82
107 0.73
108 0.65
109 0.58
110 0.49
111 0.41
112 0.31
113 0.26
114 0.24
115 0.23
116 0.21
117 0.18
118 0.16
119 0.17
120 0.16
121 0.11
122 0.09
123 0.08
124 0.07
125 0.08
126 0.08
127 0.08
128 0.1
129 0.12
130 0.11
131 0.13
132 0.13
133 0.12
134 0.13
135 0.12
136 0.12
137 0.11
138 0.1
139 0.08
140 0.08
141 0.08
142 0.11
143 0.11
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.1
150 0.06
151 0.07
152 0.08
153 0.09
154 0.1
155 0.1
156 0.1
157 0.11
158 0.12
159 0.11
160 0.09
161 0.11