FuNGI

A0A060S611

Protein Details

Accession

A0A060S611

Localization Confidence

Medium

Confidence Score

13.4

NoLS Segment(s)

Position	Sequence	Protein Nature
1-22	MSSRPKPRPRPRARAPQAAATV	Hydrophilic
102-124	TGSSPRFRGRKVQKRTNRQGILP	Hydrophilic

NLS Segment(s)

Position	Sequence
4-14	RPKPRPRPRAR
83-89	KDSKKRK

Subcellular Location(s)

mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR022617 Rad60/SUMO-like_dom
Pfam	View protein in Pfam PF11976 Rad60-SLD

Amino Acid Sequences

MSSRPKPRPRPRARAPQAAATVALDTDVPTPSSPGASSAVTSTPPPPAVPEQSSIDDEDALFMRNQSRTAQGWRKINKLAEAKDSKKRKSSGSDSSDSEHETGSSPRFRGRKVQKRTNRQGILPDWTRKRPDEIILSSDDSDEDILAPRKSKNPMVVEISDSPVKPGGRHRSRSRSLTPPPALSQYVIARAQEAVRNVVGSVGRAASPTLDVGDDTMDNIVSDPELASIARRVKAEAARQGGTPAPEGGGPENVTLRVMWKPHPLNPNGRSEVWSMRQKRHDNFHQLCAEIADLASIRSENVVLSLDGMRVFPSSTPHSVGIWAEAELEACDKITYDYLQENKRMRSESVAPSGHPHLDIACRRSPSRARSPSFTELSDSGFGAAESEPEEKDAGAAGAFTLFVVSEKTKGRRINLRVLPRTKCGVIVRKFLEKAGLQADYPERAPVAKGRGRGTTKVPVLSVDGEKMDPEAQIGEVDLEDGDQVEVVGL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.91
2	0.84
3	0.82
4	0.74
5	0.65
6	0.55
7	0.44
8	0.36
9	0.25
10	0.21
11	0.12
12	0.09
13	0.1
14	0.1
15	0.1
16	0.1
17	0.12
18	0.12
19	0.14
20	0.13
21	0.13
22	0.15
23	0.14
24	0.14
25	0.15
26	0.16
27	0.15
28	0.17
29	0.16
30	0.18
31	0.18
32	0.18
33	0.21
34	0.25
35	0.3
36	0.32
37	0.34
38	0.34
39	0.36
40	0.38
41	0.34
42	0.29
43	0.24
44	0.2
45	0.19
46	0.15
47	0.13
48	0.12
49	0.12
50	0.15
51	0.16
52	0.18
53	0.18
54	0.22
55	0.24
56	0.33
57	0.41
58	0.44
59	0.52
60	0.56
61	0.6
62	0.61
63	0.61
64	0.6
65	0.58
66	0.55
67	0.56
68	0.59
69	0.59
70	0.63
71	0.68
72	0.66
73	0.66
74	0.66
75	0.62
76	0.63
77	0.65
78	0.66
79	0.65
80	0.64
81	0.58
82	0.57
83	0.52
84	0.45
85	0.37
86	0.27
87	0.2
88	0.17
89	0.17
90	0.19
91	0.22
92	0.21
93	0.26
94	0.3
95	0.31
96	0.4
97	0.48
98	0.54
99	0.6
100	0.7
101	0.74
102	0.82
103	0.9
104	0.91
105	0.84
106	0.76
107	0.73
108	0.66
109	0.64
110	0.59
111	0.57
112	0.52
113	0.54
114	0.56
115	0.5
116	0.51
117	0.46
118	0.45
119	0.44
120	0.41
121	0.38
122	0.37
123	0.37
124	0.32
125	0.28
126	0.23
127	0.16
128	0.13
129	0.1
130	0.07
131	0.09
132	0.11
133	0.12
134	0.14
135	0.16
136	0.21
137	0.25
138	0.28
139	0.32
140	0.33
141	0.37
142	0.4
143	0.39
144	0.39
145	0.36
146	0.35
147	0.3
148	0.26
149	0.22
150	0.2
151	0.19
152	0.17
153	0.24
154	0.32
155	0.39
156	0.47
157	0.54
158	0.6
159	0.66
160	0.71
161	0.69
162	0.67
163	0.65
164	0.67
165	0.61
166	0.54
167	0.5
168	0.46
169	0.41
170	0.32
171	0.29
172	0.2
173	0.21
174	0.2
175	0.18
176	0.15
177	0.14
178	0.15
179	0.15
180	0.15
181	0.12
182	0.11
183	0.11
184	0.11
185	0.12
186	0.1
187	0.08
188	0.08
189	0.07
190	0.07
191	0.07
192	0.07
193	0.06
194	0.06
195	0.06
196	0.05
197	0.05
198	0.05
199	0.05
200	0.05
201	0.05
202	0.05
203	0.05
204	0.04
205	0.04
206	0.04
207	0.04
208	0.03
209	0.03
210	0.03
211	0.03
212	0.04
213	0.04
214	0.04
215	0.08
216	0.1
217	0.13
218	0.13
219	0.13
220	0.16
221	0.2
222	0.24
223	0.26
224	0.27
225	0.26
226	0.26
227	0.26
228	0.24
229	0.2
230	0.17
231	0.11
232	0.08
233	0.08
234	0.08
235	0.08
236	0.08
237	0.07
238	0.07
239	0.08
240	0.07
241	0.07
242	0.07
243	0.08
244	0.09
245	0.1
246	0.11
247	0.18
248	0.21
249	0.26
250	0.33
251	0.34
252	0.41
253	0.43
254	0.48
255	0.44
256	0.43
257	0.39
258	0.35
259	0.36
260	0.33
261	0.37
262	0.34
263	0.37
264	0.45
265	0.5
266	0.52
267	0.56
268	0.58
269	0.61
270	0.6
271	0.61
272	0.54
273	0.48
274	0.43
275	0.35
276	0.27
277	0.17
278	0.13
279	0.07
280	0.05
281	0.04
282	0.04
283	0.04
284	0.04
285	0.04
286	0.04
287	0.04
288	0.05
289	0.05
290	0.05
291	0.06
292	0.07
293	0.07
294	0.08
295	0.08
296	0.07
297	0.07
298	0.07
299	0.07
300	0.1
301	0.13
302	0.15
303	0.17
304	0.18
305	0.18
306	0.19
307	0.18
308	0.16
309	0.13
310	0.11
311	0.09
312	0.08
313	0.08
314	0.07
315	0.07
316	0.06
317	0.05
318	0.05
319	0.05
320	0.06
321	0.07
322	0.07
323	0.08
324	0.13
325	0.19
326	0.22
327	0.29
328	0.33
329	0.34
330	0.38
331	0.38
332	0.34
333	0.34
334	0.38
335	0.37
336	0.4
337	0.38
338	0.35
339	0.36
340	0.37
341	0.33
342	0.26
343	0.21
344	0.15
345	0.21
346	0.24
347	0.26
348	0.28
349	0.3
350	0.31
351	0.38
352	0.43
353	0.44
354	0.51
355	0.56
356	0.55
357	0.58
358	0.64
359	0.64
360	0.6
361	0.52
362	0.45
363	0.36
364	0.35
365	0.3
366	0.23
367	0.17
368	0.14
369	0.13
370	0.11
371	0.1
372	0.07
373	0.08
374	0.1
375	0.09
376	0.1
377	0.11
378	0.09
379	0.09
380	0.09
381	0.07
382	0.06
383	0.06
384	0.05
385	0.04
386	0.04
387	0.04
388	0.04
389	0.03
390	0.04
391	0.07
392	0.08
393	0.12
394	0.18
395	0.22
396	0.29
397	0.34
398	0.4
399	0.47
400	0.53
401	0.59
402	0.62
403	0.68
404	0.71
405	0.74
406	0.72
407	0.67
408	0.65
409	0.55
410	0.53
411	0.5
412	0.51
413	0.49
414	0.53
415	0.52
416	0.55
417	0.56
418	0.5
419	0.48
420	0.39
421	0.37
422	0.33
423	0.3
424	0.22
425	0.26
426	0.28
427	0.24
428	0.24
429	0.22
430	0.18
431	0.17
432	0.19
433	0.2
434	0.26
435	0.28
436	0.33
437	0.35
438	0.44
439	0.48
440	0.5
441	0.51
442	0.52
443	0.52
444	0.49
445	0.46
446	0.39
447	0.37
448	0.37
449	0.33
450	0.26
451	0.23
452	0.21
453	0.2
454	0.21
455	0.19
456	0.14
457	0.13
458	0.11
459	0.1
460	0.1
461	0.1
462	0.09
463	0.08
464	0.08
465	0.07
466	0.07
467	0.06
468	0.06
469	0.06
470	0.05

A0A060S611

3D AlphaFold-predicted Structure Viewer