Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SIH5

Protein Details
Accession A0A060SIH5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-99GTTPLKNPTKSNKDKKRKDKQTPSKSAPQSGHydrophilic
NLS Segment(s)
PositionSequence
78-89KSNKDKKRKDKQ
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSQPSPSASIVSLPTTENSAVSPSSSTATLLPAKGSQAELPTSAPKGASPPKNYEAAFAALSSSYGFSGTTPLKNPTKSNKDKKRKDKQTPSKSAPQSGSPQSPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.14
5 0.12
6 0.13
7 0.12
8 0.11
9 0.12
10 0.1
11 0.11
12 0.11
13 0.11
14 0.09
15 0.13
16 0.14
17 0.13
18 0.13
19 0.12
20 0.13
21 0.13
22 0.13
23 0.11
24 0.11
25 0.11
26 0.11
27 0.12
28 0.13
29 0.13
30 0.12
31 0.11
32 0.09
33 0.13
34 0.19
35 0.24
36 0.26
37 0.3
38 0.32
39 0.36
40 0.36
41 0.32
42 0.27
43 0.23
44 0.2
45 0.14
46 0.12
47 0.08
48 0.09
49 0.07
50 0.06
51 0.04
52 0.04
53 0.05
54 0.04
55 0.08
56 0.1
57 0.12
58 0.14
59 0.19
60 0.24
61 0.26
62 0.31
63 0.37
64 0.46
65 0.54
66 0.63
67 0.69
68 0.76
69 0.84
70 0.91
71 0.93
72 0.93
73 0.94
74 0.95
75 0.95
76 0.95
77 0.95
78 0.91
79 0.9
80 0.83
81 0.79
82 0.71
83 0.65
84 0.61
85 0.58
86 0.57