Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060SLM4

Protein Details
Accession A0A060SLM4    Localization Confidence High Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
379-413GFRTPKKQSKISPPKPTRRSPRKLASSKKQPRPVTHydrophilic
546-570QACPAAPPRTPKKTPPRRPGSSGDAHydrophilic
NLS Segment(s)
PositionSequence
377-410RYGFRTPKKQSKISPPKPTRRSPRKLASSKKQPR
556-563PKKTPPRR
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences MRAAPLDEEDCLPYTLPPGPYSELKPELSYAAIIGQAILASPGHALALQDIYEYITTVYPYYKRGEPTWMNSVRHALSTMAVFRKVQRDRSEGKSLWAIWDCDLPCFEGGGFKKTLCADMNSASSLRSSRKRGGDEVGGSRYKRKKTEDPLTADEDAVEATPVAAPIPILPPYFPPMLAPNPYHQPYYLAACAQQQLPADVLFPPLPPSSNYHRVISRAGSIAAKLQQPLKQLEIPTASQVADTTDEQEPPNTSPVERPPSSSSVPELVPSLSASSSPAPSSQLSLPDESSRDPSPVVAWATSQLDGPIEDPEAPWLHSDVPMPQEVMSTLSSARRDKGKAREQDTDNTVGRRLQTMSALPPPPSPTPERRAANTPRYGFRTPKKQSKISPPKPTRRSPRKLASSKKQPRPVTPPLMTASFDDIMRAMEQHATSGEKSRSSSPLSEVEVATMVMSACSDVEEASVPPSPDLPRFTPLPSTPPNRLAELEAEIFDFSPCKSPETRHVPRNCLSPALVDDIHNLVPPIHNPRAPYLRPDGLEDSFPSQACPAAPPRTPKKTPPRRPGSSGDARIDSPFRTPSRGLPNGFDDDFGSFFQSPGGSGLFDSFLPSLSKSPILYGLQSPGFGAQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.21
4 0.19
5 0.22
6 0.25
7 0.29
8 0.33
9 0.37
10 0.37
11 0.36
12 0.37
13 0.34
14 0.31
15 0.28
16 0.24
17 0.17
18 0.13
19 0.12
20 0.1
21 0.09
22 0.08
23 0.06
24 0.06
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.1
39 0.09
40 0.09
41 0.09
42 0.08
43 0.09
44 0.1
45 0.14
46 0.14
47 0.17
48 0.21
49 0.25
50 0.28
51 0.29
52 0.38
53 0.4
54 0.44
55 0.52
56 0.55
57 0.52
58 0.5
59 0.53
60 0.45
61 0.4
62 0.35
63 0.25
64 0.19
65 0.2
66 0.23
67 0.21
68 0.22
69 0.22
70 0.25
71 0.34
72 0.38
73 0.43
74 0.44
75 0.49
76 0.53
77 0.59
78 0.64
79 0.55
80 0.54
81 0.51
82 0.45
83 0.43
84 0.41
85 0.35
86 0.26
87 0.31
88 0.28
89 0.24
90 0.24
91 0.2
92 0.17
93 0.16
94 0.15
95 0.16
96 0.17
97 0.2
98 0.21
99 0.19
100 0.23
101 0.23
102 0.27
103 0.22
104 0.23
105 0.21
106 0.23
107 0.25
108 0.23
109 0.23
110 0.19
111 0.18
112 0.18
113 0.22
114 0.26
115 0.3
116 0.36
117 0.43
118 0.47
119 0.49
120 0.51
121 0.51
122 0.49
123 0.48
124 0.46
125 0.43
126 0.4
127 0.45
128 0.47
129 0.47
130 0.48
131 0.51
132 0.55
133 0.62
134 0.71
135 0.71
136 0.71
137 0.7
138 0.69
139 0.62
140 0.52
141 0.41
142 0.31
143 0.22
144 0.15
145 0.1
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.07
155 0.09
156 0.09
157 0.1
158 0.11
159 0.15
160 0.16
161 0.15
162 0.14
163 0.16
164 0.19
165 0.23
166 0.23
167 0.23
168 0.29
169 0.31
170 0.3
171 0.27
172 0.25
173 0.23
174 0.26
175 0.24
176 0.18
177 0.17
178 0.18
179 0.19
180 0.17
181 0.18
182 0.13
183 0.13
184 0.13
185 0.12
186 0.11
187 0.1
188 0.11
189 0.09
190 0.09
191 0.11
192 0.11
193 0.12
194 0.12
195 0.17
196 0.23
197 0.31
198 0.33
199 0.33
200 0.35
201 0.35
202 0.37
203 0.33
204 0.28
205 0.2
206 0.19
207 0.16
208 0.15
209 0.16
210 0.17
211 0.17
212 0.16
213 0.18
214 0.19
215 0.22
216 0.24
217 0.24
218 0.24
219 0.23
220 0.24
221 0.24
222 0.22
223 0.2
224 0.19
225 0.16
226 0.13
227 0.12
228 0.1
229 0.1
230 0.09
231 0.11
232 0.11
233 0.13
234 0.13
235 0.14
236 0.15
237 0.14
238 0.16
239 0.14
240 0.13
241 0.15
242 0.21
243 0.27
244 0.26
245 0.28
246 0.29
247 0.33
248 0.33
249 0.31
250 0.27
251 0.22
252 0.22
253 0.19
254 0.16
255 0.12
256 0.11
257 0.1
258 0.09
259 0.06
260 0.06
261 0.07
262 0.08
263 0.08
264 0.08
265 0.09
266 0.1
267 0.1
268 0.12
269 0.12
270 0.15
271 0.16
272 0.16
273 0.17
274 0.16
275 0.17
276 0.15
277 0.17
278 0.14
279 0.13
280 0.12
281 0.11
282 0.11
283 0.12
284 0.12
285 0.09
286 0.08
287 0.09
288 0.11
289 0.11
290 0.1
291 0.08
292 0.07
293 0.07
294 0.08
295 0.06
296 0.06
297 0.06
298 0.05
299 0.07
300 0.07
301 0.08
302 0.07
303 0.07
304 0.07
305 0.08
306 0.09
307 0.09
308 0.1
309 0.1
310 0.1
311 0.09
312 0.09
313 0.08
314 0.1
315 0.08
316 0.07
317 0.08
318 0.1
319 0.12
320 0.13
321 0.15
322 0.17
323 0.19
324 0.25
325 0.34
326 0.4
327 0.45
328 0.49
329 0.55
330 0.54
331 0.57
332 0.53
333 0.49
334 0.41
335 0.35
336 0.3
337 0.24
338 0.21
339 0.18
340 0.16
341 0.12
342 0.12
343 0.13
344 0.15
345 0.19
346 0.2
347 0.19
348 0.19
349 0.22
350 0.22
351 0.24
352 0.26
353 0.26
354 0.29
355 0.37
356 0.38
357 0.37
358 0.44
359 0.48
360 0.51
361 0.52
362 0.5
363 0.46
364 0.5
365 0.5
366 0.48
367 0.47
368 0.5
369 0.5
370 0.57
371 0.6
372 0.6
373 0.64
374 0.69
375 0.75
376 0.73
377 0.77
378 0.77
379 0.81
380 0.82
381 0.85
382 0.85
383 0.84
384 0.82
385 0.8
386 0.81
387 0.81
388 0.83
389 0.83
390 0.82
391 0.83
392 0.86
393 0.85
394 0.85
395 0.78
396 0.76
397 0.75
398 0.73
399 0.7
400 0.61
401 0.56
402 0.49
403 0.47
404 0.41
405 0.33
406 0.28
407 0.2
408 0.18
409 0.15
410 0.12
411 0.12
412 0.11
413 0.1
414 0.07
415 0.09
416 0.09
417 0.09
418 0.1
419 0.11
420 0.12
421 0.17
422 0.18
423 0.17
424 0.19
425 0.22
426 0.24
427 0.25
428 0.26
429 0.24
430 0.26
431 0.28
432 0.28
433 0.25
434 0.22
435 0.19
436 0.17
437 0.14
438 0.1
439 0.07
440 0.05
441 0.05
442 0.04
443 0.04
444 0.04
445 0.04
446 0.04
447 0.04
448 0.06
449 0.06
450 0.08
451 0.1
452 0.1
453 0.1
454 0.13
455 0.14
456 0.17
457 0.21
458 0.22
459 0.22
460 0.24
461 0.26
462 0.29
463 0.28
464 0.32
465 0.34
466 0.37
467 0.39
468 0.44
469 0.44
470 0.4
471 0.4
472 0.35
473 0.3
474 0.28
475 0.25
476 0.19
477 0.17
478 0.15
479 0.14
480 0.12
481 0.11
482 0.08
483 0.13
484 0.14
485 0.17
486 0.19
487 0.22
488 0.32
489 0.41
490 0.49
491 0.52
492 0.58
493 0.61
494 0.62
495 0.66
496 0.58
497 0.5
498 0.43
499 0.36
500 0.31
501 0.3
502 0.27
503 0.21
504 0.21
505 0.21
506 0.2
507 0.18
508 0.16
509 0.12
510 0.12
511 0.15
512 0.21
513 0.24
514 0.25
515 0.26
516 0.33
517 0.41
518 0.41
519 0.43
520 0.42
521 0.43
522 0.42
523 0.45
524 0.43
525 0.36
526 0.37
527 0.33
528 0.3
529 0.27
530 0.26
531 0.22
532 0.18
533 0.18
534 0.16
535 0.18
536 0.21
537 0.25
538 0.29
539 0.37
540 0.46
541 0.54
542 0.59
543 0.65
544 0.7
545 0.75
546 0.82
547 0.84
548 0.85
549 0.83
550 0.84
551 0.81
552 0.79
553 0.78
554 0.74
555 0.68
556 0.6
557 0.54
558 0.51
559 0.46
560 0.37
561 0.31
562 0.31
563 0.28
564 0.31
565 0.31
566 0.36
567 0.44
568 0.5
569 0.49
570 0.46
571 0.49
572 0.5
573 0.48
574 0.41
575 0.32
576 0.27
577 0.26
578 0.22
579 0.21
580 0.15
581 0.15
582 0.15
583 0.14
584 0.13
585 0.14
586 0.14
587 0.1
588 0.1
589 0.11
590 0.11
591 0.11
592 0.13
593 0.11
594 0.12
595 0.13
596 0.15
597 0.16
598 0.18
599 0.21
600 0.18
601 0.2
602 0.25
603 0.25
604 0.26
605 0.26
606 0.29
607 0.28
608 0.27
609 0.26