Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SG71

Protein Details
Accession A0A060SG71   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-84GNQSESQPKRKRGRPKGSKNKKTLQAEHydrophilic
94-144TAEAPRRPRGRPPKRPKEEEHKAEGGEPSDPPPKRKRGRPRKNPLPESSGGBasic
NLS Segment(s)
PositionSequence
65-81PKRKRGRPKGSKNKKTL
95-138AEAPRRPRGRPPKRPKEEEHKAEGGEPSDPPPKRKRGRPRKNPL
156-169PPVKRKRGRPPKNA
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSDSPEPKTHDDDAKVDEIDDGSGEPETGSLLSNSVPPLPLSQAPYSLQAPVDLAILGNQSESQPKRKRGRPKGSKNKKTLQAEAAAAAAGSSTAEAPRRPRGRPPKRPKEEEHKAEGGEPSDPPPKRKRGRPRKNPLPESSGGDGGEPSSAVDAPPVKRKRGRPPKNAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.31
4 0.27
5 0.2
6 0.17
7 0.14
8 0.1
9 0.07
10 0.07
11 0.07
12 0.06
13 0.05
14 0.06
15 0.06
16 0.06
17 0.05
18 0.06
19 0.06
20 0.08
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.13
27 0.15
28 0.18
29 0.18
30 0.2
31 0.2
32 0.23
33 0.22
34 0.2
35 0.18
36 0.14
37 0.13
38 0.11
39 0.1
40 0.07
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.11
49 0.13
50 0.22
51 0.29
52 0.39
53 0.47
54 0.55
55 0.65
56 0.7
57 0.8
58 0.81
59 0.86
60 0.88
61 0.91
62 0.93
63 0.89
64 0.86
65 0.83
66 0.76
67 0.68
68 0.59
69 0.51
70 0.41
71 0.35
72 0.27
73 0.18
74 0.13
75 0.09
76 0.06
77 0.03
78 0.03
79 0.02
80 0.02
81 0.03
82 0.05
83 0.07
84 0.1
85 0.19
86 0.23
87 0.25
88 0.35
89 0.46
90 0.56
91 0.66
92 0.74
93 0.77
94 0.82
95 0.87
96 0.84
97 0.83
98 0.83
99 0.77
100 0.73
101 0.64
102 0.55
103 0.5
104 0.44
105 0.34
106 0.25
107 0.2
108 0.17
109 0.22
110 0.23
111 0.27
112 0.33
113 0.43
114 0.5
115 0.59
116 0.67
117 0.71
118 0.81
119 0.87
120 0.9
121 0.91
122 0.94
123 0.92
124 0.86
125 0.82
126 0.74
127 0.69
128 0.6
129 0.51
130 0.4
131 0.32
132 0.27
133 0.2
134 0.17
135 0.11
136 0.08
137 0.07
138 0.07
139 0.06
140 0.1
141 0.14
142 0.17
143 0.28
144 0.32
145 0.39
146 0.47
147 0.56
148 0.64
149 0.71
150 0.78