Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060S8P2

Protein Details
Accession A0A060S8P2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRSAKFHKRQKKVTSSAGSTHydrophilic
NLS Segment(s)
PositionSequence
28-57PKPKAVVSAPAPKEQKKHAGLKAKAIKHKR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGRSAKFHKRQKKVTSSAGSTAVSQPPPKPKAVVSAPAPKEQKKHAGLKAKAIKHKREGDGPVLGGADYVELMLGSRRKAKEEAAKLPKDPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.75
4 0.68
5 0.61
6 0.51
7 0.42
8 0.38
9 0.32
10 0.26
11 0.24
12 0.25
13 0.31
14 0.33
15 0.32
16 0.31
17 0.28
18 0.33
19 0.34
20 0.36
21 0.32
22 0.39
23 0.4
24 0.45
25 0.47
26 0.42
27 0.41
28 0.38
29 0.41
30 0.37
31 0.42
32 0.42
33 0.49
34 0.48
35 0.54
36 0.58
37 0.55
38 0.58
39 0.57
40 0.56
41 0.54
42 0.6
43 0.54
44 0.52
45 0.5
46 0.46
47 0.42
48 0.37
49 0.3
50 0.23
51 0.2
52 0.14
53 0.11
54 0.07
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.07
61 0.09
62 0.11
63 0.18
64 0.19
65 0.23
66 0.26
67 0.33
68 0.4
69 0.46
70 0.55
71 0.58
72 0.62
73 0.6