Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SU85

Protein Details
Accession A0A060SU85    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-129FERFRVMVEKKQRRDQVRKALAKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01929  Ribosomal_L14e  
Amino Acid Sequences MLELDSEAASSARSAHVSKPSLLPAQVFDDDNDILKHDNMPVSAQLLPSLPPHVPYSLGAPLPPRAAGTGVIRKHLEKDGTVEKWQKSSWAQKREAIAKRRTLNDFERFRVMVEKKQRRDQVRKALAKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.24
4 0.26
5 0.28
6 0.3
7 0.32
8 0.33
9 0.32
10 0.28
11 0.23
12 0.25
13 0.25
14 0.23
15 0.19
16 0.19
17 0.18
18 0.19
19 0.16
20 0.12
21 0.12
22 0.11
23 0.12
24 0.1
25 0.11
26 0.1
27 0.11
28 0.11
29 0.12
30 0.12
31 0.11
32 0.1
33 0.1
34 0.1
35 0.1
36 0.11
37 0.09
38 0.1
39 0.12
40 0.11
41 0.12
42 0.11
43 0.14
44 0.14
45 0.14
46 0.13
47 0.12
48 0.13
49 0.13
50 0.12
51 0.1
52 0.07
53 0.08
54 0.09
55 0.11
56 0.17
57 0.17
58 0.19
59 0.2
60 0.2
61 0.22
62 0.23
63 0.21
64 0.15
65 0.19
66 0.23
67 0.24
68 0.29
69 0.32
70 0.3
71 0.31
72 0.31
73 0.3
74 0.29
75 0.37
76 0.41
77 0.44
78 0.46
79 0.48
80 0.53
81 0.59
82 0.63
83 0.61
84 0.58
85 0.58
86 0.6
87 0.62
88 0.6
89 0.57
90 0.56
91 0.57
92 0.56
93 0.51
94 0.5
95 0.45
96 0.42
97 0.45
98 0.41
99 0.4
100 0.46
101 0.53
102 0.56
103 0.65
104 0.73
105 0.74
106 0.81
107 0.82
108 0.82
109 0.83
110 0.83
111 0.78