Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SVI2

Protein Details
Accession A0A060SVI2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
205-225AGEDKDCEDRPRKKSKRDGDEAcidic
NLS Segment(s)
PositionSequence
217-218KK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR021487  DUF3140  
Pfam View protein in Pfam  
PF11338  DUF3140  
Amino Acid Sequences MVKSRRDVIMQFNEEVNMTANELERWLDGPKSTKAGTGAGIESGHKIVEILRKNPTRDPEKYDDEDIEHMRKVVSYTKRHLAQEDHLKETKTRTELENTKSTISLKNWGHDPIKTLDVESEEEPSEDEQPQEPPKQNDNEKLSESDSGGNVPASTDEKATNKRKLDDEDSPETQDGDDEVDAEADEVDVGEAASVDKAEADSVDAGEDKDCEDRPRKKSKRDGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.25
4 0.16
5 0.13
6 0.12
7 0.12
8 0.11
9 0.12
10 0.12
11 0.1
12 0.11
13 0.12
14 0.12
15 0.14
16 0.18
17 0.21
18 0.24
19 0.24
20 0.25
21 0.24
22 0.24
23 0.24
24 0.21
25 0.19
26 0.16
27 0.16
28 0.15
29 0.14
30 0.13
31 0.11
32 0.08
33 0.08
34 0.1
35 0.17
36 0.21
37 0.23
38 0.31
39 0.36
40 0.39
41 0.44
42 0.49
43 0.49
44 0.48
45 0.53
46 0.51
47 0.53
48 0.54
49 0.51
50 0.45
51 0.39
52 0.39
53 0.33
54 0.29
55 0.22
56 0.19
57 0.16
58 0.15
59 0.15
60 0.19
61 0.24
62 0.28
63 0.32
64 0.39
65 0.44
66 0.45
67 0.46
68 0.41
69 0.41
70 0.46
71 0.44
72 0.42
73 0.39
74 0.39
75 0.37
76 0.37
77 0.34
78 0.25
79 0.23
80 0.2
81 0.26
82 0.31
83 0.35
84 0.38
85 0.34
86 0.33
87 0.32
88 0.31
89 0.28
90 0.23
91 0.26
92 0.22
93 0.22
94 0.23
95 0.26
96 0.26
97 0.22
98 0.24
99 0.18
100 0.19
101 0.17
102 0.16
103 0.13
104 0.13
105 0.14
106 0.12
107 0.12
108 0.1
109 0.1
110 0.1
111 0.1
112 0.11
113 0.09
114 0.09
115 0.09
116 0.11
117 0.15
118 0.19
119 0.22
120 0.24
121 0.29
122 0.34
123 0.38
124 0.43
125 0.44
126 0.43
127 0.41
128 0.39
129 0.35
130 0.3
131 0.27
132 0.2
133 0.16
134 0.13
135 0.12
136 0.1
137 0.09
138 0.08
139 0.08
140 0.08
141 0.09
142 0.09
143 0.11
144 0.15
145 0.24
146 0.31
147 0.37
148 0.39
149 0.42
150 0.45
151 0.49
152 0.51
153 0.5
154 0.51
155 0.5
156 0.49
157 0.48
158 0.44
159 0.38
160 0.31
161 0.23
162 0.17
163 0.12
164 0.09
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.06
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.06
188 0.07
189 0.07
190 0.08
191 0.09
192 0.09
193 0.09
194 0.1
195 0.09
196 0.12
197 0.14
198 0.2
199 0.29
200 0.38
201 0.46
202 0.57
203 0.65
204 0.72
205 0.81