Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SNZ7

Protein Details
Accession A0A060SNZ7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-37TSSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
14-31GGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVVLDKATYDRIIKEVPTFRFISQSILIERLKINGSLARIAIRHLEKEGQIKRIVHHSGQLIYTRSTGGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.34
4 0.41
5 0.45
6 0.54
7 0.62
8 0.7
9 0.77
10 0.82
11 0.84
12 0.86
13 0.9
14 0.9
15 0.91
16 0.88
17 0.83
18 0.8
19 0.71
20 0.63
21 0.53
22 0.45
23 0.36
24 0.3
25 0.23
26 0.16
27 0.15
28 0.12
29 0.12
30 0.09
31 0.08
32 0.09
33 0.1
34 0.1
35 0.14
36 0.19
37 0.19
38 0.22
39 0.23
40 0.21
41 0.23
42 0.23
43 0.22
44 0.18
45 0.18
46 0.15
47 0.18
48 0.17
49 0.16
50 0.16
51 0.14
52 0.14
53 0.12
54 0.13
55 0.11
56 0.12
57 0.12
58 0.13
59 0.13
60 0.12
61 0.13
62 0.18
63 0.17
64 0.17
65 0.18
66 0.2
67 0.21
68 0.3
69 0.33
70 0.32
71 0.35
72 0.35
73 0.35
74 0.41
75 0.42
76 0.34
77 0.35
78 0.34
79 0.32
80 0.33
81 0.35
82 0.3
83 0.27
84 0.27
85 0.23